NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|62901068|sp|O76021|]
View 

RecName: Full=Ribosomal L1 domain-containing protein 1; AltName: Full=CATX-11; AltName: Full=Cellular senescence-inhibited gene protein; AltName: Full=Protein PBK1 [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ribosomal_L1 cd00403
Ribosomal protein L1. The L1 protein, located near the E-site of the ribosome, forms part of ...
36-263 1.16e-42

Ribosomal protein L1. The L1 protein, located near the E-site of the ribosome, forms part of the L1 stalk along with 23S rRNA. In bacteria and archaea, L1 functions both as a ribosomal protein that binds rRNA, and as a translation repressor that binds its own mRNA. Like several other large ribosomal subunit proteins, L1 displays RNA chaperone activity. L1 is one of the largest ribosomal proteins. It is composed of two domains that cycle between open and closed conformations via a hinge motion. The RNA-binding site of L1 is highly conserved, with both mRNA and rRNA binding the same binding site.


:

Pssm-ID: 238235  Cd Length: 208  Bit Score: 151.57  E-value: 1.16e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068  36 VRKAVDALLTHCKsrknnygLLLNENESLFLMVVLWKIPSKE---LRVRLTLPHSIRSDSEdICLFTKDEPNSTPEKTeq 112
Cdd:cd00403   1 LEEAIKALKKTSV-------KKRKFDETVELQINLKKDDRKKdqrIRGTVILPHGLGKDVK-VCVFAKDEQAKEAKAA-- 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068 113 fyrkllnkhgiktVSQIISLQTLKKEYKSYEAKlRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKVPVSVNL-LSKNLS 191
Cdd:cd00403  71 -------------GADVVGGEDLKKKIKNGEAK-KLAKDFDLFLADPRIMMLLPKLLGKVLGPRGKMPNPKTGtVTEDLA 136
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 62901068 192 REINDCIGGTVLNISKSGsCSAIRIGHVGMQIEHIIENIVAVTKGLSEKLPE-KWESVKLLFVKTEKSAALPI 263
Cdd:cd00403 137 KAIEEAKSSVEFRLDKGG-CIHVPVGKVSMSPEQLVENIEAVINALVKKLPSkKGQNIKSIYLKTTMGPSLPI 208
 
Name Accession Description Interval E-value
Ribosomal_L1 cd00403
Ribosomal protein L1. The L1 protein, located near the E-site of the ribosome, forms part of ...
36-263 1.16e-42

Ribosomal protein L1. The L1 protein, located near the E-site of the ribosome, forms part of the L1 stalk along with 23S rRNA. In bacteria and archaea, L1 functions both as a ribosomal protein that binds rRNA, and as a translation repressor that binds its own mRNA. Like several other large ribosomal subunit proteins, L1 displays RNA chaperone activity. L1 is one of the largest ribosomal proteins. It is composed of two domains that cycle between open and closed conformations via a hinge motion. The RNA-binding site of L1 is highly conserved, with both mRNA and rRNA binding the same binding site.


Pssm-ID: 238235  Cd Length: 208  Bit Score: 151.57  E-value: 1.16e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068  36 VRKAVDALLTHCKsrknnygLLLNENESLFLMVVLWKIPSKE---LRVRLTLPHSIRSDSEdICLFTKDEPNSTPEKTeq 112
Cdd:cd00403   1 LEEAIKALKKTSV-------KKRKFDETVELQINLKKDDRKKdqrIRGTVILPHGLGKDVK-VCVFAKDEQAKEAKAA-- 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068 113 fyrkllnkhgiktVSQIISLQTLKKEYKSYEAKlRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKVPVSVNL-LSKNLS 191
Cdd:cd00403  71 -------------GADVVGGEDLKKKIKNGEAK-KLAKDFDLFLADPRIMMLLPKLLGKVLGPRGKMPNPKTGtVTEDLA 136
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 62901068 192 REINDCIGGTVLNISKSGsCSAIRIGHVGMQIEHIIENIVAVTKGLSEKLPE-KWESVKLLFVKTEKSAALPI 263
Cdd:cd00403 137 KAIEEAKSSVEFRLDKGG-CIHVPVGKVSMSPEQLVENIEAVINALVKKLPSkKGQNIKSIYLKTTMGPSLPI 208
Ribosomal_L1 pfam00687
Ribosomal protein L1p/L10e family; This family includes prokaryotic L1 and eukaryotic L10.
40-260 3.59e-46

Ribosomal protein L1p/L10e family; This family includes prokaryotic L1 and eukaryotic L10.


Pssm-ID: 250056  Cd Length: 201  Bit Score: 160.83  E-value: 3.59e-46
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068    40 VDALLTHCKSRKnnyglllnENESLFLMVVLWKIPSKE---LRVRLTLPHSIRSDSEdICLFTKDEPNStpekteqfyrk 116
Cdd:pfam00687   1 VKALKKLSKKRK--------FDETVELQINLKKDPRKKdqnVRGTVVLPHGLGKDVK-VCVIAKDPQAK----------- 60
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068   117 llNKHGIKTVSQIISLQTLKKEYKsYEAKLRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKVPVSVNLLSKNLSREIND 196
Cdd:pfam00687  61 --AKEAKDAGADVVGGEDLKKKYK-IKKGRKLAKDFDLFLADPRIMPLLPKLLGKILGPRGKMPNPKTTVTMDLAAAIEE 137
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 62901068   197 CIGGTVLNISKSGSCSAIRIGHVGMQIEHIIENIVAVTKGLSEKLPEKWESVKLLFVKTEKSAA 260
Cdd:pfam00687 138 AKSGTVFFRKDKGGCIHVKVGKVSMTPEELVENIKAVINALVSLLPKGWQNIKSVYLKTTMGPS 201
PTZ00225 PTZ00225
60S ribosomal protein L10a; Provisional
34-255 1.61e-06

60S ribosomal protein L10a; Provisional


Pssm-ID: 140252  Cd Length: 214  Bit Score: 47.73  E-value: 1.61e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068   34 EQVRKAVDALLTHCKSRKNNyglllnenESLFLMVVLWKI-PSKELRVR--LTLPHSIRSdSEDICLFTkdepnstpekt 110
Cdd:PTZ00225   7 QTLSEAIQAVLKVDKERKFK--------ESIDLQVNLKNYdPQKDKRFSgsLKLPNVCRP-RMTVCLLC----------- 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068  111 EQFYRKLLNKHGIKTVSQiislQTLKKEYKSYEAKLRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKVPvSVNLLSKNL 190
Cdd:PTZ00225  67 DLVHEDIAKKEGVPTMNQ----EELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFP-TVCSPSESL 141
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 62901068  191 SREINDcIGGTVLNISKSGSCSAIRIGHVGMQIEHIIENIVAVTKGLSEKLPEKWESVKLLFVKT 255
Cdd:PTZ00225 142 PDKVVE-LRSTVKFQLKKVLCLGTCVGHVEMTEEQLRQNVVMAINFLVSLLKKNWQNLKSAYIKS 205
RplA COG0081
Ribosomal protein L1 [Translation, ribosomal structure and biogenesis]
152-255 6.50e-04

Ribosomal protein L1 [Translation, ribosomal structure and biogenesis]


Pssm-ID: 223159  Cd Length: 228  Bit Score: 39.90  E-value: 6.50e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068 152 FDFFLTDARIRRLLPSLiGRHFYQRKKVP-VSVNLLSKNLSREINDCIGGTVLNISKSGSCSAIRIGHVGMQIEHIIENI 230
Cdd:COG0081 112 FDVFIATPDMMPLVGKL-GKVLGPRGLMPnPKTGTVTDDVAKAVEELKKGTVEFRADKAGVIHVPIGKVSFDDEKLAENI 190
                        90       100
                ....*....|....*....|....*..
gi 62901068 231 VAVTKGLSEKLP--EKWESVKLLFVKT 255
Cdd:COG0081 191 EALLNAIVKAKPagAKGQYIKSVYVST 217
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
324-462 8.37e-07

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 50.46  E-value: 8.37e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068  324 ESGDTTVKKPESKKEQTPEHGKKKRGRGKAQVKATNESEDEIPQLVPIGKKTPANEKVEiqKHATGKKSPAKSPNPSTPR 403
Cdd:PTZ00449 527 KEGEEGEHEDSKESDEPKEGGKPGETKEGEVGKKPGPAKEHKPSKIPTLSKKPEFPKDP--KHPKDPEEPKKPKRPRSAQ 604
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 62901068  404 GKKRKALP----ASETPKAAESETPGKSPEKKPKIKEEAVKEKSPSLGKKDARQTPKKPEAKF 462
Cdd:PTZ00449 605 RPTRPKSPklpeLLDIPKSPKRPESPKSPKRPPPPQRPSSPERPEGPKIIKSPKPPKSPKPPF 667
valS PRK14900
valyl-tRNA synthetase; Provisional
334-474 1.53e-05

valyl-tRNA synthetase; Provisional


Pssm-ID: 237855 [Multi-domain]  Cd Length: 1052  Bit Score: 46.14  E-value: 1.53e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068   334 ESKKEQTP-EHGKKKRGRGKAQVKATNESEDEIPQLVPIGKKTPANEKVEIQKHATGKKSPAKSPnpstprGKKRKALPA 412
Cdd:PRK14900  917 EIQNEQKPtQDGPAAEAQPAQENTVVESAEKAVAAVSEAAQQAATAVASGIEKVAEAVRKTVRRS------VKKAAATRA 990
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 62901068   413 SETPKAAESETPGKSPEKKPKIKEEAVKeKSPSlGKKDARQTPKKPEAKffTTPSKSVRKAS 474
Cdd:PRK14900  991 AMKKKVAKKAPAKKAAAKKAAAKKAAAK-KKVA-KKAPAKKVARKPAAK--KAAKKPARKAA 1048
NESP55 pfam06390
Neuroendocrine-specific golgi protein P55 (NESP55); This family consists of several mammalian ...
318-460 5.39e-05

Neuroendocrine-specific golgi protein P55 (NESP55); This family consists of several mammalian neuroendocrine-specific golgi protein P55 (NESP55) sequences. NESP55 is a novel member of the chromogranin family and is a soluble, acidic, heat-stable secretory protein that is expressed exclusively in endocrine and nervous tissues, although less widely than chromogranins.


Pssm-ID: 115071 [Multi-domain]  Cd Length: 261  Bit Score: 43.70  E-value: 5.39e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068   318 KDDVAPESGDTTVKKPESKKEQTPEHGKKKRGRGKAQVKATNESEDEIPQLVPigKKTPANEKVEIQKHATGKKSPAKSP 397
Cdd:pfam06390 109 EDDFDTETDSETEPESDIESETEFETEPETEPDTAPTTEPETEPEDEPGPVVP--KGATFHQSLTERLHALKLQSADASP 186
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 62901068   398 NPSTPRGKKRKALPASETPKAAESETPGKSPEKKPKIKEEAVKEKSPSLGKKDARQTPKKPEA 460
Cdd:pfam06390 187 RRAPPSTQEPESAREGEEPERGPLDKDPRDPEEEEEEKEEEKQQPHRCKPKKPARRRDPSPES 249
DedD COG3147
Uncharacterized protein conserved in bacteria [Function unknown]
360-460 5.15e-03

Uncharacterized protein conserved in bacteria [Function unknown]


Pssm-ID: 225689 [Multi-domain]  Cd Length: 226  Bit Score: 37.17  E-value: 5.15e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068 360 ESEDEIPQLVP-IGKKTPANEKVEIQKHATGkkSPAKSPNPSTPRGKKRKALPASETPKAAESETPGKSPEKKPKIKEEA 438
Cdd:COG3147  52 DEPRVLPAVVQvVALPTQPPEGVAQEIQDAG--DAAAASVDPQPVAQPPVESTPAGVPVAAQTPKPVKPPKQPPAGAVPA 129
                        90       100
                ....*....|....*....|..
gi 62901068 439 VKEKSPSLGKKDARQTPKKPEA 460
Cdd:COG3147 130 KPTPKPEPKPVAEPAAAPTGQA 151
 
Name Accession Description Interval E-value
Ribosomal_L1 cd00403
Ribosomal protein L1. The L1 protein, located near the E-site of the ribosome, forms part of ...
36-263 1.16e-42

Ribosomal protein L1. The L1 protein, located near the E-site of the ribosome, forms part of the L1 stalk along with 23S rRNA. In bacteria and archaea, L1 functions both as a ribosomal protein that binds rRNA, and as a translation repressor that binds its own mRNA. Like several other large ribosomal subunit proteins, L1 displays RNA chaperone activity. L1 is one of the largest ribosomal proteins. It is composed of two domains that cycle between open and closed conformations via a hinge motion. The RNA-binding site of L1 is highly conserved, with both mRNA and rRNA binding the same binding site.


Pssm-ID: 238235  Cd Length: 208  Bit Score: 151.57  E-value: 1.16e-42
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068  36 VRKAVDALLTHCKsrknnygLLLNENESLFLMVVLWKIPSKE---LRVRLTLPHSIRSDSEdICLFTKDEPNSTPEKTeq 112
Cdd:cd00403   1 LEEAIKALKKTSV-------KKRKFDETVELQINLKKDDRKKdqrIRGTVILPHGLGKDVK-VCVFAKDEQAKEAKAA-- 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068 113 fyrkllnkhgiktVSQIISLQTLKKEYKSYEAKlRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKVPVSVNL-LSKNLS 191
Cdd:cd00403  71 -------------GADVVGGEDLKKKIKNGEAK-KLAKDFDLFLADPRIMMLLPKLLGKVLGPRGKMPNPKTGtVTEDLA 136
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 62901068 192 REINDCIGGTVLNISKSGsCSAIRIGHVGMQIEHIIENIVAVTKGLSEKLPE-KWESVKLLFVKTEKSAALPI 263
Cdd:cd00403 137 KAIEEAKSSVEFRLDKGG-CIHVPVGKVSMSPEQLVENIEAVINALVKKLPSkKGQNIKSIYLKTTMGPSLPI 208
Ribosomal_L1 pfam00687
Ribosomal protein L1p/L10e family; This family includes prokaryotic L1 and eukaryotic L10.
40-260 3.59e-46

Ribosomal protein L1p/L10e family; This family includes prokaryotic L1 and eukaryotic L10.


Pssm-ID: 250056  Cd Length: 201  Bit Score: 160.83  E-value: 3.59e-46
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068    40 VDALLTHCKSRKnnyglllnENESLFLMVVLWKIPSKE---LRVRLTLPHSIRSDSEdICLFTKDEPNStpekteqfyrk 116
Cdd:pfam00687   1 VKALKKLSKKRK--------FDETVELQINLKKDPRKKdqnVRGTVVLPHGLGKDVK-VCVIAKDPQAK----------- 60
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068   117 llNKHGIKTVSQIISLQTLKKEYKsYEAKLRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKVPVSVNLLSKNLSREIND 196
Cdd:pfam00687  61 --AKEAKDAGADVVGGEDLKKKYK-IKKGRKLAKDFDLFLADPRIMPLLPKLLGKILGPRGKMPNPKTTVTMDLAAAIEE 137
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 62901068   197 CIGGTVLNISKSGSCSAIRIGHVGMQIEHIIENIVAVTKGLSEKLPEKWESVKLLFVKTEKSAA 260
Cdd:pfam00687 138 AKSGTVFFRKDKGGCIHVKVGKVSMTPEELVENIKAVINALVSLLPKGWQNIKSVYLKTTMGPS 201
PTZ00225 PTZ00225
60S ribosomal protein L10a; Provisional
34-255 1.61e-06

60S ribosomal protein L10a; Provisional


Pssm-ID: 140252  Cd Length: 214  Bit Score: 47.73  E-value: 1.61e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068   34 EQVRKAVDALLTHCKSRKNNyglllnenESLFLMVVLWKI-PSKELRVR--LTLPHSIRSdSEDICLFTkdepnstpekt 110
Cdd:PTZ00225   7 QTLSEAIQAVLKVDKERKFK--------ESIDLQVNLKNYdPQKDKRFSgsLKLPNVCRP-RMTVCLLC----------- 66
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068  111 EQFYRKLLNKHGIKTVSQiislQTLKKEYKSYEAKLRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKVPvSVNLLSKNL 190
Cdd:PTZ00225  67 DLVHEDIAKKEGVPTMNQ----EELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFP-TVCSPSESL 141
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 62901068  191 SREINDcIGGTVLNISKSGSCSAIRIGHVGMQIEHIIENIVAVTKGLSEKLPEKWESVKLLFVKT 255
Cdd:PTZ00225 142 PDKVVE-LRSTVKFQLKKVLCLGTCVGHVEMTEEQLRQNVVMAINFLVSLLKKNWQNLKSAYIKS 205
PTZ00029 PTZ00029
60S ribosomal protein L10a; Provisional
130-264 9.11e-05

60S ribosomal protein L10a; Provisional


Pssm-ID: 185405  Cd Length: 216  Bit Score: 42.42  E-value: 9.11e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068  130 ISLQTLKKEYKSYEAKLRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKVPVSVnLLSKNLSREINDCiGGTVLNISKSG 209
Cdd:PTZ00029  84 MDIEGLKKFNKNKKLVKKLAKKYDAFLASQSLLPQIPRLLGPGLNKAGKFPTLI-THNDDIEDKINEL-KSSVKFQLKKV 161
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 62901068  210 SCSAIRIGHVGMQIEHIIENIVAVTKGLSEKLPEKWESVKLLFVKTEKSAALPIF 264
Cdd:PTZ00029 162 LCLGVAVGNVEMTEEQLRQNIVLSINFLVSLLKKNWQNIKTLHIKSTMGKPQRIY 216
RplA COG0081
Ribosomal protein L1 [Translation, ribosomal structure and biogenesis]
152-255 6.50e-04

Ribosomal protein L1 [Translation, ribosomal structure and biogenesis]


Pssm-ID: 223159  Cd Length: 228  Bit Score: 39.90  E-value: 6.50e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068 152 FDFFLTDARIRRLLPSLiGRHFYQRKKVP-VSVNLLSKNLSREINDCIGGTVLNISKSGSCSAIRIGHVGMQIEHIIENI 230
Cdd:COG0081 112 FDVFIATPDMMPLVGKL-GKVLGPRGLMPnPKTGTVTDDVAKAVEELKKGTVEFRADKAGVIHVPIGKVSFDDEKLAENI 190
                        90       100
                ....*....|....*....|....*..
gi 62901068 231 VAVTKGLSEKLP--EKWESVKLLFVKT 255
Cdd:COG0081 191 EALLNAIVKAKPagAKGQYIKSVYVST 217
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
324-462 8.37e-07

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 50.46  E-value: 8.37e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068  324 ESGDTTVKKPESKKEQTPEHGKKKRGRGKAQVKATNESEDEIPQLVPIGKKTPANEKVEiqKHATGKKSPAKSPNPSTPR 403
Cdd:PTZ00449 527 KEGEEGEHEDSKESDEPKEGGKPGETKEGEVGKKPGPAKEHKPSKIPTLSKKPEFPKDP--KHPKDPEEPKKPKRPRSAQ 604
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 62901068  404 GKKRKALP----ASETPKAAESETPGKSPEKKPKIKEEAVKEKSPSLGKKDARQTPKKPEAKF 462
Cdd:PTZ00449 605 RPTRPKSPklpeLLDIPKSPKRPESPKSPKRPPPPQRPSSPERPEGPKIIKSPKPPKSPKPPF 667
valS PRK14900
valyl-tRNA synthetase; Provisional
334-474 1.53e-05

valyl-tRNA synthetase; Provisional


Pssm-ID: 237855 [Multi-domain]  Cd Length: 1052  Bit Score: 46.14  E-value: 1.53e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068   334 ESKKEQTP-EHGKKKRGRGKAQVKATNESEDEIPQLVPIGKKTPANEKVEIQKHATGKKSPAKSPnpstprGKKRKALPA 412
Cdd:PRK14900  917 EIQNEQKPtQDGPAAEAQPAQENTVVESAEKAVAAVSEAAQQAATAVASGIEKVAEAVRKTVRRS------VKKAAATRA 990
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 62901068   413 SETPKAAESETPGKSPEKKPKIKEEAVKeKSPSlGKKDARQTPKKPEAKffTTPSKSVRKAS 474
Cdd:PRK14900  991 AMKKKVAKKAPAKKAAAKKAAAKKAAAK-KKVA-KKAPAKKVARKPAAK--KAAKKPARKAA 1048
NESP55 pfam06390
Neuroendocrine-specific golgi protein P55 (NESP55); This family consists of several mammalian ...
318-460 5.39e-05

Neuroendocrine-specific golgi protein P55 (NESP55); This family consists of several mammalian neuroendocrine-specific golgi protein P55 (NESP55) sequences. NESP55 is a novel member of the chromogranin family and is a soluble, acidic, heat-stable secretory protein that is expressed exclusively in endocrine and nervous tissues, although less widely than chromogranins.


Pssm-ID: 115071 [Multi-domain]  Cd Length: 261  Bit Score: 43.70  E-value: 5.39e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068   318 KDDVAPESGDTTVKKPESKKEQTPEHGKKKRGRGKAQVKATNESEDEIPQLVPigKKTPANEKVEIQKHATGKKSPAKSP 397
Cdd:pfam06390 109 EDDFDTETDSETEPESDIESETEFETEPETEPDTAPTTEPETEPEDEPGPVVP--KGATFHQSLTERLHALKLQSADASP 186
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 62901068   398 NPSTPRGKKRKALPASETPKAAESETPGKSPEKKPKIKEEAVKEKSPSLGKKDARQTPKKPEA 460
Cdd:pfam06390 187 RRAPPSTQEPESAREGEEPERGPLDKDPRDPEEEEEEKEEEKQQPHRCKPKKPARRRDPSPES 249
PTZ00449 PTZ00449
104 kDa microneme/rhoptry antigen; Provisional
364-474 7.04e-04

104 kDa microneme/rhoptry antigen; Provisional


Pssm-ID: 185628 [Multi-domain]  Cd Length: 943  Bit Score: 40.83  E-value: 7.04e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068  364 EIPQLVPIGKKT-PANEKVEIQKHATGKKSPAKSPNPSTPRGKKRKALPASETPKAAESETPGKSPE--------KKPKI 434
Cdd:PTZ00449 484 EIKKLIKKSKKKlAPIEEEDSDKHDEPPEGPEASGLPPKAPGDKEGEEGEHEDSKESDEPKEGGKPGetkegevgKKPGP 563
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 62901068  435 KEEAVKEKSPSLGKKDA----RQTPKKPE----AKFFTTPSKSVRKAS 474
Cdd:PTZ00449 564 AKEHKPSKIPTLSKKPEfpkdPKHPKDPEepkkPKRPRSAQRPTRPKS 611
PRK13808 PRK13808
adenylate kinase; Provisional
371-473 1.97e-03

adenylate kinase; Provisional


Pssm-ID: 172341 [Multi-domain]  Cd Length: 333  Bit Score: 39.10  E-value: 1.97e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068  371 IGKKTPANEKVEIQKHATGKKSPAKSPNPSTPRGKKRKALPASETPKAAESETPGKSPEKKPKIKEEAVKEKSPSLGKKD 450
Cdd:PRK13808 187 IGRVLAAVGAANAKKAAKTPAAKSGAKKASAKAKSAAKKVSKKKAAKTAVSAKKAAKTAAKAAKKAKKTAKKALKKAAKA 266
                         90       100
                 ....*....|....*....|...
gi 62901068  451 ARQTPKKPeAKFFTTPSKSVRKA 473
Cdd:PRK13808 267 VKKAAKKA-AKAAAKAAKGAAKA 288
DedD COG3147
Uncharacterized protein conserved in bacteria [Function unknown]
360-460 5.15e-03

Uncharacterized protein conserved in bacteria [Function unknown]


Pssm-ID: 225689 [Multi-domain]  Cd Length: 226  Bit Score: 37.17  E-value: 5.15e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068 360 ESEDEIPQLVP-IGKKTPANEKVEIQKHATGkkSPAKSPNPSTPRGKKRKALPASETPKAAESETPGKSPEKKPKIKEEA 438
Cdd:COG3147  52 DEPRVLPAVVQvVALPTQPPEGVAQEIQDAG--DAAAASVDPQPVAQPPVESTPAGVPVAAQTPKPVKPPKQPPAGAVPA 129
                        90       100
                ....*....|....*....|..
gi 62901068 439 VKEKSPSLGKKDARQTPKKPEA 460
Cdd:COG3147 130 KPTPKPEPKPVAEPAAAPTGQA 151
AF-4 pfam05110
AF-4 proto-oncoprotein; This family consists of AF4 (Proto-oncogene AF4) and FMR2 (Fragile X E ...
332-473 6.55e-03

AF-4 proto-oncoprotein; This family consists of AF4 (Proto-oncogene AF4) and FMR2 (Fragile X E mental retardation syndrome) nuclear proteins. These proteins have been linked to human diseases such as acute lymphoblastic leukaemia and mental retardation. The family also contains a Drosophila AF4 protein homologue Lilliputian which contains an AT-hook domain. Lilliputian represents a novel pair-rule gene that acts in cytoskeleton regulation, segmentation and morphogenesis in Drosophila.


Pssm-ID: 253015 [Multi-domain]  Cd Length: 1154  Bit Score: 37.98  E-value: 6.55e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62901068    332 KPESKKEQTPEHGKKKRGRGKAQVKATNESEDEIPQLVPIGKKTPANEKVEIQKHATGKKSPAKSPNPSTPRGKK--RKA 409
Cdd:pfam05110  480 KVKSSGSQYHPESKEPPPKSSSKEKRRPRTAQKGPESGRGKQKSPAQSEAPPQRRTVGKKQPKKPEKASAGDERTglRPE 559
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 62901068    410 LPASETPKAAESETPGKSPEKKPKIKEEAVKEKSPSlgkkdaRQTPKKPEAKFFTTPSKSVRKA 473
Cdd:pfam05110  560 SEPGTLPYGSSVQTPPDRPKAATKGSRKPSPRKEPK------SSVPPAAEKRKYKSPSKIVPKS 617
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH