NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|57977327|ref|NP_001009151|]
View 

beta-defensin 1 precursor [Pan troglodytes]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Defensin_beta pfam00711
Beta defensin; The beta defensins are antimicrobial peptides implicated in the resistance of ...
34-68 2.67e-06

Beta defensin; The beta defensins are antimicrobial peptides implicated in the resistance of epithelial surfaces to microbial colonisation.


:

Pssm-ID: 250075  Cd Length: 35  Bit Score: 39.57  E-value: 2.67e-06
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 57977327   34 HYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68
Cdd:pfam00711  1 PVSCRRNGGFCRPGRCPGGERQIGTCSGPKVKCCR 35
 
Name Accession Description Interval E-value
Defensin_beta pfam00711
Beta defensin; The beta defensins are antimicrobial peptides implicated in the resistance of ...
34-68 2.67e-06

Beta defensin; The beta defensins are antimicrobial peptides implicated in the resistance of epithelial surfaces to microbial colonisation.


Pssm-ID: 250075  Cd Length: 35  Bit Score: 39.57  E-value: 2.67e-06
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 57977327   34 HYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68
Cdd:pfam00711  1 PVSCRRNGGFCRPGRCPGGERQIGTCSGPKVKCCR 35
 
Name Accession Description Interval E-value
Defensin_beta pfam00711
Beta defensin; The beta defensins are antimicrobial peptides implicated in the resistance of ...
34-68 2.67e-06

Beta defensin; The beta defensins are antimicrobial peptides implicated in the resistance of epithelial surfaces to microbial colonisation.


Pssm-ID: 250075  Cd Length: 35  Bit Score: 39.57  E-value: 2.67e-06
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 57977327   34 HYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK 68
Cdd:pfam00711  1 PVSCRRNGGFCRPGRCPGGERQIGTCSGPKVKCCR 35
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH