NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|55586453|ref|XP_524604.1|]
View 

PREDICTED: 5-hydroxytryptamine receptor 1D [Pan troglodytes]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
62-356 1.79e-68

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


:

Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 218.33  E-value: 1.79e-68
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453    62 TILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAIT 141
Cdd:pfam00001   2 VILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453   142 DALEYSKRRTAGHAATMIAIVWAISICISIPPLF--WRQAKAQEEMSDCLVN----TSQISYTIYSTCGAFYIPSVLLII 215
Cdd:pfam00001  82 HPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLfsWLRTVEEGNVTTCLIDfpeeSTLRSYTLLSTLLGFVLPLLVILV 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453   216 LYGRIYRAARNRILNPPSlygkrfttahlitgsagsslcslnsslheghshsagsplffnhvkikladsaLERKRISAAR 295
Cdd:pfam00001 162 CYTLILRTLRKRARSGAS----------------------------------------------------QARAKRSSSK 189
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 55586453   296 ERKATKTLGIILGAFIICWLPFFVVSLVLPICRDSCW-IHPALFDFFTWLGYLNSLINPIIY 356
Cdd:pfam00001 190 ERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSIIrLLPTALLITLWLAYVNSCLNPIIY 251
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
62-356 1.79e-68

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 218.33  E-value: 1.79e-68
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453    62 TILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAIT 141
Cdd:pfam00001   2 VILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453   142 DALEYSKRRTAGHAATMIAIVWAISICISIPPLF--WRQAKAQEEMSDCLVN----TSQISYTIYSTCGAFYIPSVLLII 215
Cdd:pfam00001  82 HPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLfsWLRTVEEGNVTTCLIDfpeeSTLRSYTLLSTLLGFVLPLLVILV 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453   216 LYGRIYRAARNRILNPPSlygkrfttahlitgsagsslcslnsslheghshsagsplffnhvkikladsaLERKRISAAR 295
Cdd:pfam00001 162 CYTLILRTLRKRARSGAS----------------------------------------------------QARAKRSSSK 189
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 55586453   296 ERKATKTLGIILGAFIICWLPFFVVSLVLPICRDSCW-IHPALFDFFTWLGYLNSLINPIIY 356
Cdd:pfam00001 190 ERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSIIrLLPTALLITLWLAYVNSCLNPIIY 251
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
17-377 2.49e-12

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 65.96  E-value: 2.49e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453   17 NRSLNATETSEAWDPRTLQA----LKISLAVVLSIITLATVLSNAFVLTtILLTRKLHTPANYLIGSLATTDLLVsILVM 92
Cdd:PHA03087  15 TDYYYDTYYDEDYADCDLNIgydtNSTILIVVYSTIFFFGLVGNIIVIY-VLTKTKIKTPMDIYLLNLAVSDLLF-VMTL 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453   93 PISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIP 172
Cdd:PHA03087  93 PFQIYYYILFQWSFGEFACKIVSGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTP 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453  173 PLFWRQAKAQEEMSDCLV--NTSQISYTIYSTCG----AFYIPSVLLIILYGRIYraarnrilnppslygkrfttahlit 246
Cdd:PHA03087 173 ILFVYTTKKDHETLICCMfyNNKTMNWKLFINFEiniiGMLIPLTILLYCYSKIL------------------------- 227
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453  247 gsagsslcslnsslheghshsagsplffnhvkIKLADSALERKRisaareRKATKTLGIILGAFIICWLPFFVVSLVLPI 326
Cdd:PHA03087 228 --------------------------------ITLKGINKSKKN------KKAIKLVLIIVILFVIFWLPFNVSVFVYSL 269
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 55586453  327 --------CRDSCWIHPALFDFFTwLGYLNSLINPIIYTVFNEEFRQAFQKIVPFRKAS 377
Cdd:PHA03087 270 hilhfksgCKAVKYIQYALHVTEI-ISLSHCCINPLIYAFVSEFFNKHKKKSLKLMFTS 327
 
Name Accession Description Interval E-value
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
62-356 1.79e-68

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 218.33  E-value: 1.79e-68
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453    62 TILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAIT 141
Cdd:pfam00001   2 VILRTKKLRTPTNIFLLNLAVADLLFLLTLPPWALYYLVGGDWPFGDALCKLVGFLFVVNGYASILLLTAISIDRYLAIV 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453   142 DALEYSKRRTAGHAATMIAIVWAISICISIPPLF--WRQAKAQEEMSDCLVN----TSQISYTIYSTCGAFYIPSVLLII 215
Cdd:pfam00001  82 HPLRYRRIRTPRRAKVLILVVWVLALLLSLPPLLfsWLRTVEEGNVTTCLIDfpeeSTLRSYTLLSTLLGFVLPLLVILV 161
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453   216 LYGRIYRAARNRILNPPSlygkrfttahlitgsagsslcslnsslheghshsagsplffnhvkikladsaLERKRISAAR 295
Cdd:pfam00001 162 CYTLILRTLRKRARSGAS----------------------------------------------------QARAKRSSSK 189
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 55586453   296 ERKATKTLGIILGAFIICWLPFFVVSLVLPICRDSCW-IHPALFDFFTWLGYLNSLINPIIY 356
Cdd:pfam00001 190 ERKAAKMLLVVVVVFVLCWLPYHIVLLLDSLCPLSIIrLLPTALLITLWLAYVNSCLNPIIY 251
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
17-377 2.49e-12

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 65.96  E-value: 2.49e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453   17 NRSLNATETSEAWDPRTLQA----LKISLAVVLSIITLATVLSNAFVLTtILLTRKLHTPANYLIGSLATTDLLVsILVM 92
Cdd:PHA03087  15 TDYYYDTYYDEDYADCDLNIgydtNSTILIVVYSTIFFFGLVGNIIVIY-VLTKTKIKTPMDIYLLNLAVSDLLF-VMTL 92
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453   93 PISIAYTITHTWNFGQILCDIWLSSDITCCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIP 172
Cdd:PHA03087  93 PFQIYYYILFQWSFGEFACKIVSGLYYIGFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTP 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453  173 PLFWRQAKAQEEMSDCLV--NTSQISYTIYSTCG----AFYIPSVLLIILYGRIYraarnrilnppslygkrfttahlit 246
Cdd:PHA03087 173 ILFVYTTKKDHETLICCMfyNNKTMNWKLFINFEiniiGMLIPLTILLYCYSKIL------------------------- 227
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453  247 gsagsslcslnsslheghshsagsplffnhvkIKLADSALERKRisaareRKATKTLGIILGAFIICWLPFFVVSLVLPI 326
Cdd:PHA03087 228 --------------------------------ITLKGINKSKKN------KKAIKLVLIIVILFVIFWLPFNVSVFVYSL 269
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 55586453  327 --------CRDSCWIHPALFDFFTwLGYLNSLINPIIYTVFNEEFRQAFQKIVPFRKAS 377
Cdd:PHA03087 270 hilhfksgCKAVKYIQYALHVTEI-ISLSHCCINPLIYAFVSEFFNKHKKKSLKLMFTS 327
PHA02638 PHA02638
CC chemokine receptor-like protein; Provisional
47-364 1.98e-07

CC chemokine receptor-like protein; Provisional


Pssm-ID: 165021 [Multi-domain]  Cd Length: 417  Bit Score: 51.17  E-value: 1.98e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453   47 IITLATVLSNAFVLTtILLTRKLHTPANYLIGSLATTDLLVsILVMPIsIAYTITHTWNFGQILCDIWLSSDITCCTASI 126
Cdd:PHA02638 107 IIFILGLFGNAAIIM-ILFCKKIKTITDIYIFNLAISDLIF-VIDFPF-IIYNEFDQWIFGDFMCKVISASYYIGFFSNM 183
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453  127 LHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAKAqeemsdcLVNTSQISYTIYST--CG 204
Cdd:PHA02638 184 FLITLMSIDRYFAILYPISFQKYRTFNIGIILCIISWILSLIITSPAYFIFEASN-------IIFSAQDSNETISNyqCT 256
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453  205 AFYIPSVLLIILYGRIYRAARN--RILNPPSLYGkrfttahlitgsagsslcslnsslheghshsagsplfFNHVKIkla 282
Cdd:PHA02638 257 LIEDNEKNNISFLGRILQFEINilGMFIPIIIFA-------------------------------------FCYIKI--- 296
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453  283 dsALERKRISAARERKATKTLGIILGAFIICWLPFFVVSLVLPICRD---SCWIHPALFDFFTwLGYLNSL--------- 350
Cdd:PHA02638 297 --ILKLKQLKKSKKTKSIIIVSIIIICSLICWIPLNIVILFATMYSFkgfNSIISEHICGFIK-LGYAMMLaeaislthc 373
                        330
                 ....*....|....*
gi 55586453  351 -INPIIYTVFNEEFR 364
Cdd:PHA02638 374 cINPLIYTLIGENFR 388
PHA02834 PHA02834
chemokine receptor-like protein; Provisional
43-226 5.60e-04

chemokine receptor-like protein; Provisional


Pssm-ID: 165177 [Multi-domain]  Cd Length: 323  Bit Score: 40.27  E-value: 5.60e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453   43 VVLSIITLATVLSNAFVLTTILLTRKLHTPANYLIgSLATTDLLVsILVMPIsIAYTITHTWNFGQILCDIWLSSDITCC 122
Cdd:PHA02834  33 VFYILLFIFGLIGNVLVIAVLIVKRFMFVVDVYLF-NIAMSDLML-VFSFPF-IIHNDLNEWIFGEFMCKLVLGVYFVGF 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 55586453  123 TASILHLCVIALDRYWAITDALEYsKRRTAGHAATMIAIVWAISICISIPPLFWRQAKAQEEMSDCLVNTSQISYTIYST 202
Cdd:PHA02834 110 FSNMFFVTLISIDRYILVVNATKI-KNKSISLSVLLSVAAWVCSVILSMPAMVLYYVDNTDNLKQCIFNDYHENFSWSAF 188
                        170       180       190
                 ....*....|....*....|....*....|
gi 55586453  203 CG------AFYIPSVLLIILYGRIYRAARN 226
Cdd:PHA02834 189 FNfeinifGIVIPLIILIYCYSKILYTLKN 218
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH