NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|53988378|ref|NP_005814|]
View 

mesothelin isoform 1 preproprotein [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Mesothelin pfam06060
Pre-pro-megakaryocyte potentiating factor precursor (Mesothelin); This family consists of ...
1-608 0e+00

Pre-pro-megakaryocyte potentiating factor precursor (Mesothelin); This family consists of several mammalian pre-pro-megakaryocyte potentiating factor precursor (MPF) or mesothelin proteins. Mesothelin is a glycosylphosphatidylinositol-linked glycoprotein highly expressed in mesothelial cells, mesotheliomas, and ovarian cancer, but the biological function of the protein is not known.


:

Pssm-ID: 114764  Cd Length: 625  Bit Score: 1082.28  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378     1 MALPTARPLLGSCGTPALGSLLFLLFSLG-WVQPSRTLAGETGQEAAPLDGVlANPPNISSLSPRQLLGFPCAEVSGLST 79
Cdd:pfam06060   1 MALPTARPLLGSCGSPICSRSFLLLLLSLgWVPPLQTQTTETSQEAALLHAV-AGPPDFASLPTGLFLGLPCAEVSGLSM 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378    80 ERVRELAVALAQKNVKLSTEQLRCLAHRLSE--PPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAP 157
Cdd:pfam06060  80 ERAKELAMAVRQKNIKLSTHQLRCLARRLPEhlTPEELDALPLDLLLFLNPAMFPGQQACAHFFSLISKANVDVLPRRSL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   158 ERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPP 237
Cdd:pfam06060 160 ERQRLLPAALKCQGVYGFQVSEADVRALGGLACDLPGRFVAESSEVLLPWLASCPGPLDQDQQKAVREVLRSGRPPYGPP 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   238 STWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERTILRPRFRREVEKTACPSGKKAREIDESLIF 317
Cdd:pfam06060 240 STWSVSTLDALQGLLPVLDESIVRSIPKDVVAEWLQRISRDPSRLGSKRTVLHPRFRRDVEQKACPPGKEPREVDESLIF 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   318 YKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQGYPESVIQHLGYLFLKMSPEDIRKWNVTSLETLKA 397
Cdd:pfam06060 320 YQNWELEACVDGTLLATQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIRQWNVTSPDTVKT 399
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   398 LLEVNKGHEMSPQVATLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSLSPEELSSVPPSSIWAVRPQDLDTCDPRQLDVLY 477
Cdd:pfam06060 400 LLKVSKGQKMSAQVIALVACYLRGGGQLDEDTVKALTAIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGVLY 479
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   478 PKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHR 557
Cdd:pfam06060 480 QKACSAFQNVSGLEYFEKIQTFLGGASTEDLRALSQHNVSMDIATFKKLQVDALVGLSVAEVQKLLGPHIEDLKTEEDKS 559
                         570       580       590       600       610
                  ....*....|....*....|....*....|....*....|....*....|.
gi 53988378   558 PVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLSMQEALSGTPCLLGPGP 608
Cdd:pfam06060 560 PVRDWLFRQRQKDLDTLGLGLQGGIPNGYLVLDFNVREAFSSTACLLGPGF 610
 
Name Accession Description Interval E-value
Mesothelin pfam06060
Pre-pro-megakaryocyte potentiating factor precursor (Mesothelin); This family consists of ...
1-608 0e+00

Pre-pro-megakaryocyte potentiating factor precursor (Mesothelin); This family consists of several mammalian pre-pro-megakaryocyte potentiating factor precursor (MPF) or mesothelin proteins. Mesothelin is a glycosylphosphatidylinositol-linked glycoprotein highly expressed in mesothelial cells, mesotheliomas, and ovarian cancer, but the biological function of the protein is not known.


Pssm-ID: 114764  Cd Length: 625  Bit Score: 1082.28  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378     1 MALPTARPLLGSCGTPALGSLLFLLFSLG-WVQPSRTLAGETGQEAAPLDGVlANPPNISSLSPRQLLGFPCAEVSGLST 79
Cdd:pfam06060   1 MALPTARPLLGSCGSPICSRSFLLLLLSLgWVPPLQTQTTETSQEAALLHAV-AGPPDFASLPTGLFLGLPCAEVSGLSM 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378    80 ERVRELAVALAQKNVKLSTEQLRCLAHRLSE--PPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAP 157
Cdd:pfam06060  80 ERAKELAMAVRQKNIKLSTHQLRCLARRLPEhlTPEELDALPLDLLLFLNPAMFPGQQACAHFFSLISKANVDVLPRRSL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   158 ERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPP 237
Cdd:pfam06060 160 ERQRLLPAALKCQGVYGFQVSEADVRALGGLACDLPGRFVAESSEVLLPWLASCPGPLDQDQQKAVREVLRSGRPPYGPP 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   238 STWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERTILRPRFRREVEKTACPSGKKAREIDESLIF 317
Cdd:pfam06060 240 STWSVSTLDALQGLLPVLDESIVRSIPKDVVAEWLQRISRDPSRLGSKRTVLHPRFRRDVEQKACPPGKEPREVDESLIF 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   318 YKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQGYPESVIQHLGYLFLKMSPEDIRKWNVTSLETLKA 397
Cdd:pfam06060 320 YQNWELEACVDGTLLATQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIRQWNVTSPDTVKT 399
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   398 LLEVNKGHEMSPQVATLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSLSPEELSSVPPSSIWAVRPQDLDTCDPRQLDVLY 477
Cdd:pfam06060 400 LLKVSKGQKMSAQVIALVACYLRGGGQLDEDTVKALTAIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGVLY 479
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   478 PKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHR 557
Cdd:pfam06060 480 QKACSAFQNVSGLEYFEKIQTFLGGASTEDLRALSQHNVSMDIATFKKLQVDALVGLSVAEVQKLLGPHIEDLKTEEDKS 559
                         570       580       590       600       610
                  ....*....|....*....|....*....|....*....|....*....|.
gi 53988378   558 PVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLSMQEALSGTPCLLGPGP 608
Cdd:pfam06060 560 PVRDWLFRQRQKDLDTLGLGLQGGIPNGYLVLDFNVREAFSSTACLLGPGF 610
 
Name Accession Description Interval E-value
Mesothelin pfam06060
Pre-pro-megakaryocyte potentiating factor precursor (Mesothelin); This family consists of ...
1-608 0e+00

Pre-pro-megakaryocyte potentiating factor precursor (Mesothelin); This family consists of several mammalian pre-pro-megakaryocyte potentiating factor precursor (MPF) or mesothelin proteins. Mesothelin is a glycosylphosphatidylinositol-linked glycoprotein highly expressed in mesothelial cells, mesotheliomas, and ovarian cancer, but the biological function of the protein is not known.


Pssm-ID: 114764  Cd Length: 625  Bit Score: 1082.28  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378     1 MALPTARPLLGSCGTPALGSLLFLLFSLG-WVQPSRTLAGETGQEAAPLDGVlANPPNISSLSPRQLLGFPCAEVSGLST 79
Cdd:pfam06060   1 MALPTARPLLGSCGSPICSRSFLLLLLSLgWVPPLQTQTTETSQEAALLHAV-AGPPDFASLPTGLFLGLPCAEVSGLSM 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378    80 ERVRELAVALAQKNVKLSTEQLRCLAHRLSE--PPEDLDALPLDLLLFLNPDAFSGPQACTRFFSRITKANVDLLPRGAP 157
Cdd:pfam06060  80 ERAKELAMAVRQKNIKLSTHQLRCLARRLPEhlTPEELDALPLDLLLFLNPAMFPGQQACAHFFSLISKANVDVLPRRSL 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   158 ERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVSCPGPLDQDQQEAARAALQGGGPPYGPP 237
Cdd:pfam06060 160 ERQRLLPAALKCQGVYGFQVSEADVRALGGLACDLPGRFVAESSEVLLPWLASCPGPLDQDQQKAVREVLRSGRPPYGPP 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   238 STWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPSWRQPERTILRPRFRREVEKTACPSGKKAREIDESLIF 317
Cdd:pfam06060 240 STWSVSTLDALQGLLPVLDESIVRSIPKDVVAEWLQRISRDPSRLGSKRTVLHPRFRRDVEQKACPPGKEPREVDESLIF 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   318 YKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQGYPESVIQHLGYLFLKMSPEDIRKWNVTSLETLKA 397
Cdd:pfam06060 320 YQNWELEACVDGTLLATQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIRQWNVTSPDTVKT 399
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   398 LLEVNKGHEMSPQVATLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSLSPEELSSVPPSSIWAVRPQDLDTCDPRQLDVLY 477
Cdd:pfam06060 400 LLKVSKGQKMSAQVIALVACYLRGGGQLDEDTVKALTAIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGVLY 479
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53988378   478 PKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKAEERHR 557
Cdd:pfam06060 480 QKACSAFQNVSGLEYFEKIQTFLGGASTEDLRALSQHNVSMDIATFKKLQVDALVGLSVAEVQKLLGPHIEDLKTEEDKS 559
                         570       580       590       600       610
                  ....*....|....*....|....*....|....*....|....*....|.
gi 53988378   558 PVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLSMQEALSGTPCLLGPGP 608
Cdd:pfam06060 560 PVRDWLFRQRQKDLDTLGLGLQGGIPNGYLVLDFNVREAFSSTACLLGPGF 610
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH