NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|53716774|ref|YP_104973|]
View 

methyl-accepting chemotaxis protein [Burkholderia mallei ATCC 23344]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
232-429 7.31e-50

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


:

Pssm-ID: 206779  Cd Length: 200  Bit Score: 170.11  E-value: 7.31e-50
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 232 QATALQQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNI 311
Cdd:cd11386   3 LSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 312 LALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQ 391
Cdd:cd11386  83 LALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFE 162
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 53716774 392 DIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHAA 429
Cdd:cd11386 163 EIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Cache_2 super family cl07034
Cache domain;
2-61 7.22e-20

Cache domain;


The actual alignment was detected with superfamily member pfam08269:

Pssm-ID: 297994  Cd Length: 95  Bit Score: 84.29  E-value: 7.22e-20
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774     2 LTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHY 61
Cdd:pfam08269  35 LTREEAQAQAKALLRALRYDGDGYFFIYDSNGTNVMHPIKPELVGKNLSNLKDPNGKALF 94
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
104-451 4.14e-59

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


:

Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 200.99  E-value: 4.14e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 104 DWIISTGAYIDDIQAAFAKSLCLSAGVFALLAALLALSVVYTNRGIERMIGGDPRIAAHMAGVIASGDLATPFATRREDR 183
Cdd:COG0840  35 KLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDE 114
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 184 -SSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRDTADRARAASE 262
Cdd:COG0840 115 fGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAA 194
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 263 LAGSAARITDRGGDMVVRVVAAMNDIRAESRKMV-----------DIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFA 331
Cdd:COG0840 195 LASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVkklsessqeieEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFA 274
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 332 VVASEVRVLAQRSASAAKDIRALIGRA--------------AERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAA 397
Cdd:COG0840 275 VVADEVRKLAERSADSAKEIGLLIEEIqneaadavehmeesASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAAT 354
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|....
gi 53716774 398 TDQSQGLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRT 451
Cdd:COG0840 355 EEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
232-429 7.31e-50

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 170.11  E-value: 7.31e-50
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 232 QATALQQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNI 311
Cdd:cd11386   3 LSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 312 LALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQ 391
Cdd:cd11386  83 LALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFE 162
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 53716774 392 DIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHAA 429
Cdd:cd11386 163 EIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Cache_2 pfam08269
Cache domain;
2-61 7.22e-20

Cache domain;


Pssm-ID: 285469  Cd Length: 95  Bit Score: 84.29  E-value: 7.22e-20
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774     2 LTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHY 61
Cdd:pfam08269  35 LTREEAQAQAKALLRALRYDGDGYFFIYDSNGTNVMHPIKPELVGKNLSNLKDPNGKALF 94
Cache_2 smart01049
Cache is an extracellular domain that is predicted to have a role in small-molecule ...
2-59 8.97e-18

Cache is an extracellular domain that is predicted to have a role in small-molecule recognition in a wide range of proteins; Members include the animal dihydropyridine-sensitive voltage-gated Ca2+ channel; alpha-2delta subunit, and various bacterial chemotaxis receptors. The name Cache comes from CAlcium channels and CHEmotaxis receptors. This domain consists of an N-terminal part with three predicted strands and an alpha-helix, and a C-terminal part with a strand dyad followed by a relatively unstructured region. The N-terminal portion of the (unpermuted) Cache domain contains three predicted strands that could form a sheet analogous to that present in the core of the PAS domain structure. Cache domains are particularly widespread in bacteria, with Vibrio cholerae. The animal calcium channel alpha-2delta subunits might have acquired a part of their extracellular domains from a bacterial source. The Cache domain appears to have arisen from the GAF-PAS fold despite their divergent functions.


Pssm-ID: 214995  Cd Length: 91  Bit Score: 78.45  E-value: 8.97e-18
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 53716774      2 LTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRH 59
Cdd:smart01049  32 LTEEEAQAQAKAALRALRYGGDGYFFVYDSDGVMLMHPAKPELEGKNLSDLKDPNGKY 89
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
104-451 4.14e-59

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 200.99  E-value: 4.14e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 104 DWIISTGAYIDDIQAAFAKSLCLSAGVFALLAALLALSVVYTNRGIERMIGGDPRIAAHMAGVIASGDLATPFATRREDR 183
Cdd:COG0840  35 KLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDE 114
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 184 -SSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRDTADRARAASE 262
Cdd:COG0840 115 fGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAA 194
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 263 LAGSAARITDRGGDMVVRVVAAMNDIRAESRKMV-----------DIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFA 331
Cdd:COG0840 195 LASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVkklsessqeieEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFA 274
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 332 VVASEVRVLAQRSASAAKDIRALIGRA--------------AERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAA 397
Cdd:COG0840 275 VVADEVRKLAERSADSAKEIGLLIEEIqneaadavehmeesASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAAT 354
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|....
gi 53716774 398 TDQSQGLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRT 451
Cdd:COG0840 355 EEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
158-453 2.18e-83

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 269.18  E-value: 2.18e-83
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774  158 RIAAHMAGvIASGDLATPFATR-REDRSSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATAL 236
Cdd:PRK15048 222 KIIAHIRE-IAGGNLANTLTIDgRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASAL 300
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774  237 QQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNA 316
Cdd:PRK15048 301 EETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNA 380
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774  317 AVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAA 396
Cdd:PRK15048 381 AVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASA 460
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 53716774  397 ATDQSQGLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRTEA 453
Cdd:PRK15048 461 SDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFRLAA 517
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
203-450 5.87e-59

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 196.35  E-value: 5.87e-59
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774    203 QIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVV 282
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774    283 AAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIG------ 356
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKeiqeet 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774    357 --------RAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHA 428
Cdd:smart00283 161 neavaameESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|..
gi 53716774    429 AIAAQSLNEQSRCLQDAVAAFR 450
Cdd:smart00283 241 SAAAEELSGLAEELDELVERFK 262
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
257-449 5.97e-49

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444 [Multi-domain]  Cd Length: 207  Bit Score: 168.01  E-value: 5.97e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774   257 ARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFAVVASE 336
Cdd:pfam00015   1 SDLAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774   337 VRVLAQRSASAAKDIRALI--------------GRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQ 402
Cdd:pfam00015  81 VRKLAERSAQAAKEIEALIeeivkqtndstasiQQTRTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQSA 160
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 53716774   403 GLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAF 449
Cdd:pfam00015 161 GIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 207
COG4564 COG4564
Signal transduction histidine kinase [Signal transduction mechanisms];
2-122 1.75e-21

Signal transduction histidine kinase [Signal transduction mechanisms];


Pssm-ID: 226930 [Multi-domain]  Cd Length: 459  Bit Score: 95.28  E-value: 1.75e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774   2 LTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHYLTFASVAQSpQGGFVDYVFA 81
Cdd:COG4564  73 PSDEAAKQEVKAILTNLDYGSDGYFFVYDYQGTNLVHPRQPELVGQNLWQLTDPRGDRVIQALIAKAQE-GGGLHQYLWE 151
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
gi 53716774  82 HPNAHpaKAVDKLGYVIRYAPWDWIISTGAYIDDIQAAFAK 122
Cdd:COG4564 152 KPSSH--ETVDKLSYAAGLDKWEWMIGTGLYLDDVSAETAA 190
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
232-429 7.31e-50

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 170.11  E-value: 7.31e-50
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 232 QATALQQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNI 311
Cdd:cd11386   3 LSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQTNL 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 312 LALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQ 391
Cdd:cd11386  83 LALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIQEQTEEAVEAMEETSEEVEEGVELVEETGRAFE 162
                       170       180       190
                ....*....|....*....|....*....|....*...
gi 53716774 392 DIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHAA 429
Cdd:cd11386 163 EIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Cache_2 pfam08269
Cache domain;
2-61 7.22e-20

Cache domain;


Pssm-ID: 285469  Cd Length: 95  Bit Score: 84.29  E-value: 7.22e-20
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774     2 LTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHY 61
Cdd:pfam08269  35 LTREEAQAQAKALLRALRYDGDGYFFIYDSNGTNVMHPIKPELVGKNLSNLKDPNGKALF 94
Cache_2 smart01049
Cache is an extracellular domain that is predicted to have a role in small-molecule ...
2-59 8.97e-18

Cache is an extracellular domain that is predicted to have a role in small-molecule recognition in a wide range of proteins; Members include the animal dihydropyridine-sensitive voltage-gated Ca2+ channel; alpha-2delta subunit, and various bacterial chemotaxis receptors. The name Cache comes from CAlcium channels and CHEmotaxis receptors. This domain consists of an N-terminal part with three predicted strands and an alpha-helix, and a C-terminal part with a strand dyad followed by a relatively unstructured region. The N-terminal portion of the (unpermuted) Cache domain contains three predicted strands that could form a sheet analogous to that present in the core of the PAS domain structure. Cache domains are particularly widespread in bacteria, with Vibrio cholerae. The animal calcium channel alpha-2delta subunits might have acquired a part of their extracellular domains from a bacterial source. The Cache domain appears to have arisen from the GAF-PAS fold despite their divergent functions.


Pssm-ID: 214995  Cd Length: 91  Bit Score: 78.45  E-value: 8.97e-18
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 53716774      2 LTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRH 59
Cdd:smart01049  32 LTEEEAQAQAKAALRALRYGGDGYFFVYDSDGVMLMHPAKPELEGKNLSDLKDPNGKY 89
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];
104-451 4.14e-59

Methyl-accepting chemotaxis protein [Cell motility, Signal transduction mechanisms];


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 200.99  E-value: 4.14e-59
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 104 DWIISTGAYIDDIQAAFAKSLCLSAGVFALLAALLALSVVYTNRGIERMIGGDPRIAAHMAGVIASGDLATPFATRREDR 183
Cdd:COG0840  35 KLLLSLNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDESSNDE 114
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 184 -SSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRDTADRARAASE 262
Cdd:COG0840 115 fGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNAKEAAA 194
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 263 LAGSAARITDRGGDMVVRVVAAMNDIRAESRKMV-----------DIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFA 331
Cdd:COG0840 195 LASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVkklsessqeieEITSVINSIAEQTNLLALNAAIEAARAGEAGRGFA 274
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774 332 VVASEVRVLAQRSASAAKDIRALIGRA--------------AERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAA 397
Cdd:COG0840 275 VVADEVRKLAERSADSAKEIGLLIEEIqneaadavehmeesASEVSEGVKLVEETGSSLGEIAAAIEEVSQLISEIAAAT 354
                       330       340       350       360       370
                ....*....|....*....|....*....|....*....|....*....|....
gi 53716774 398 TDQSQGLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRT 451
Cdd:COG0840 355 EEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAKFKL 408
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
158-453 2.18e-83

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 269.18  E-value: 2.18e-83
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774  158 RIAAHMAGvIASGDLATPFATR-REDRSSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATAL 236
Cdd:PRK15048 222 KIIAHIRE-IAGGNLANTLTIDgRSEMGDLAQSVSHMQRSLTDTVTHVREGSDAIYAGTREIAAGNTDLSSRTEQQASAL 300
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774  237 QQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNA 316
Cdd:PRK15048 301 EETAASMEQLTATVKQNADNARQASQLAQSASDTAQHGGKVVDGVVKTMHEIADSSKKIADIISVIDGIAFQTNILALNA 380
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774  317 AVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAA 396
Cdd:PRK15048 381 AVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKALIEDSVSRVDTGSVLVESAGETMNNIVNAVTRVTDIMGEIASA 460
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 53716774  397 ATDQSQGLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRTEA 453
Cdd:PRK15048 461 SDEQSRGIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQASRLTQAVSAFRLAA 517
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
167-452 4.31e-81

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 262.97  E-value: 4.31e-81
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774  167 IASGDLATPFATRREDR-SSLMFAISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQR 245
Cdd:PRK15041 232 IAGGDLVKPIEVDGSNEmGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQ 311
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774  246 LTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGN 325
Cdd:PRK15041 312 LTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGE 391
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774  326 EGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQGLE 405
Cdd:PRK15041 392 QGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGID 471
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 53716774  406 QINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRTE 452
Cdd:PRK15041 472 QVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQ 518
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
167-452 2.60e-78

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 255.38  E-value: 2.60e-78
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774  167 IASGDLATPFATRREDRSSLMFA-ISQMRDALANAVAQIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQR 245
Cdd:PRK09793 228 IAAGNLARPIAVYGRNEITAIFAsLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQ 307
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774  246 LTERVRDTADRARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGN 325
Cdd:PRK09793 308 LTATVGQNADNARQASELAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGE 387
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774  326 EGRGFAVVASEVRVLAQRSASAAKDIRALIGRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQGLE 405
Cdd:PRK09793 388 QGRGFAVVAGEVRNLASRSAQAAKEIKGLIEESVNRVQQGSKLVNNAAATMTDIVSSVTRVNDIMGEIASASEEQRRGIE 467
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 53716774  406 QINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAFRTE 452
Cdd:PRK09793 468 QVAQAVSQMDQVTQQNASLVEEAAVATEQLANQADHLSSRVAVFTLE 514
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
203-450 5.87e-59

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 196.35  E-value: 5.87e-59
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774    203 QIRASAGYVATTAGEIADSNMDLSSHTECQATALQQAASSMQRLTERVRDTADRARAASELAGSAARITDRGGDMVVRVV 282
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774    283 AAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFAVVASEVRVLAQRSASAAKDIRALIG------ 356
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKeiqeet 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774    357 --------RAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQGLEQINAAVSQMDSVTRRNATLVEHA 428
Cdd:smart00283 161 neavaameESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240
                          250       260
                   ....*....|....*....|..
gi 53716774    429 AIAAQSLNEQSRCLQDAVAAFR 450
Cdd:smart00283 241 SAAAEELSGLAEELDELVERFK 262
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
257-449 5.97e-49

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 278444 [Multi-domain]  Cd Length: 207  Bit Score: 168.01  E-value: 5.97e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774   257 ARAASELAGSAARITDRGGDMVVRVVAAMNDIRAESRKMVDIIGVIEGIAFQTNILALNAAVEAARAGNEGRGFAVVASE 336
Cdd:pfam00015   1 SDLAQLASEEALDEMSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADE 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774   337 VRVLAQRSASAAKDIRALI--------------GRAAERVGNGAELVEATGATIGEAQHAICRVTGIVQDIAAAATDQSQ 402
Cdd:pfam00015  81 VRKLAERSAQAAKEIEALIeeivkqtndstasiQQTRTEVEVGSTIVESTGEALKEIVEAVAEIADIVQEIAAASDEQSA 160
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 53716774   403 GLEQINAAVSQMDSVTRRNATLVEHAAIAAQSLNEQSRCLQDAVAAF 449
Cdd:pfam00015 161 GIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQF 207
COG4564 COG4564
Signal transduction histidine kinase [Signal transduction mechanisms];
2-122 1.75e-21

Signal transduction histidine kinase [Signal transduction mechanisms];


Pssm-ID: 226930 [Multi-domain]  Cd Length: 459  Bit Score: 95.28  E-value: 1.75e-21
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 53716774   2 LTDAQARKEALERLRSVRYGSDGYFIVIDSSPRMIMHPIKPDTVGKDLRHVADADGRHHYLTFASVAQSpQGGFVDYVFA 81
Cdd:COG4564  73 PSDEAAKQEVKAILTNLDYGSDGYFFVYDYQGTNLVHPRQPELVGQNLWQLTDPRGDRVIQALIAKAQE-GGGLHQYLWE 151
                        90       100       110       120
                ....*....|....*....|....*....|....*....|.
gi 53716774  82 HPNAHpaKAVDKLGYVIRYAPWDWIISTGAYIDDIQAAFAK 122
Cdd:COG4564 152 KPSSH--ETVDKLSYAAGLDKWEWMIGTGLYLDDVSAETAA 190
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH