NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|49481103|ref|YP_039091|]
View 

methyl-accepting chemotaxis protein [Bacillus thuringiensis serovar konkukian str. 97-27]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
DUF4077 pfam13295
Domain of unknown function (DUF4077); This is the N-terminal region of methyl-accepting ...
1-175 1.09e-111

Domain of unknown function (DUF4077); This is the N-terminal region of methyl-accepting chemotaxis proteins from Bacillus spp. The function is not known.


:

Pssm-ID: 205475  Cd Length: 175  Bit Score: 331.20  E-value: 1.09e-111
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103     1 MEWLKKTCFSNLEKESQKNHLLLFITICSFFLGIIAIGYYGYIFTERAIAFWVCGISVVVFGTLLTFIESMESMYKYIMT 80
Cdd:pfam13295   1 MEWLKRTCFSNLEKESQKNHLLLFITICSFFLGIIAIGYYGYIFTERAIAFWMCGISVVVFGTLLTFIESMEAMYKYIMT 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    81 FMLLMMSFIMVQAFNESPAVFQMVYFTLAVSLIYLSERLVVILGGVAVVLTFILCSYWPEQFFAYTAASEAANFASLLAI 160
Cdd:pfam13295  81 FMLLIMSFIMVQAFNESPAVFQMVYFTLAVSLIYLSERLILILGGVAVVITFILCSYWPEQFFAYTASSEAANFASLLAI 160
                         170
                  ....*....|....*
gi 49481103   161 VTIAMWGVTKIGSNL 175
Cdd:pfam13295 161 VTIAMWGVTKIGSNL 175
MCP_signal super family cl19050
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
254-472 6.48e-38

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 267403  Cd Length: 200  Bit Score: 138.14  E-value: 6.48e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103 254 NDMEGNIEQIISQVRNASIRVDESLEISKGSVHTLRNFEANMKSLNDVVSQSGIIFRDLMMQSKQINEIVDVITNISSQT 333
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103 334 SLLALNANIEAARAGEHGKGFAIVANEVLKLAEESNRSAGRIQGILKEfsnqaskVEVQVEKSERVQEECNEMLASVLTN 413
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEE-------IQEQTEEAVEAMEETSEEVEEGVEL 153
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 49481103 414 VTDLGKFIDAINDVMREIVGHqenfqvkttnivkdVTHASNVIQQTSAATEEVLASVEE 472
Cdd:cd11386 154 VEETGRAFEEIVASVEEVADG--------------IQEISAATQEQSASTQEIAAAVEE 198
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
227-472 8.07e-43

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


:

Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 153.60  E-value: 8.07e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    227 DINFAFEEVAVGTQSQSEMMSRSVEVLNDMEGNIEQIISQVRNASIRVDESLEISKGSVHTLRNFEANMKSLNDVVSQSG 306
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    307 IIFRDLMMQSKQINEIVDVITNISSQTSLLALNANIEAARAGEHGKGFAIVANEVLKLAEESNRSAGRIQGILKEFSNQA 386
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    387 SKVEVQVEKSERVQEECNEMLASVLTNVTDLGKFIDAINDVMREIVGHQENFQVKTTNIVKDVTHASNVIQQTSAATEEV 466
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240

                   ....*.
gi 49481103    467 LASVEE 472
Cdd:smart00283 241 SAAAEE 246
 
Name Accession Description Interval E-value
DUF4077 pfam13295
Domain of unknown function (DUF4077); This is the N-terminal region of methyl-accepting ...
1-175 1.09e-111

Domain of unknown function (DUF4077); This is the N-terminal region of methyl-accepting chemotaxis proteins from Bacillus spp. The function is not known.


Pssm-ID: 205475  Cd Length: 175  Bit Score: 331.20  E-value: 1.09e-111
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103     1 MEWLKKTCFSNLEKESQKNHLLLFITICSFFLGIIAIGYYGYIFTERAIAFWVCGISVVVFGTLLTFIESMESMYKYIMT 80
Cdd:pfam13295   1 MEWLKRTCFSNLEKESQKNHLLLFITICSFFLGIIAIGYYGYIFTERAIAFWMCGISVVVFGTLLTFIESMEAMYKYIMT 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    81 FMLLMMSFIMVQAFNESPAVFQMVYFTLAVSLIYLSERLVVILGGVAVVLTFILCSYWPEQFFAYTAASEAANFASLLAI 160
Cdd:pfam13295  81 FMLLIMSFIMVQAFNESPAVFQMVYFTLAVSLIYLSERLILILGGVAVVITFILCSYWPEQFFAYTASSEAANFASLLAI 160
                         170
                  ....*....|....*
gi 49481103   161 VTIAMWGVTKIGSNL 175
Cdd:pfam13295 161 VTIAMWGVTKIGSNL 175
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
254-472 6.48e-38

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 138.14  E-value: 6.48e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103 254 NDMEGNIEQIISQVRNASIRVDESLEISKGSVHTLRNFEANMKSLNDVVSQSGIIFRDLMMQSKQINEIVDVITNISSQT 333
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103 334 SLLALNANIEAARAGEHGKGFAIVANEVLKLAEESNRSAGRIQGILKEfsnqaskVEVQVEKSERVQEECNEMLASVLTN 413
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEE-------IQEQTEEAVEAMEETSEEVEEGVEL 153
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 49481103 414 VTDLGKFIDAINDVMREIVGHqenfqvkttnivkdVTHASNVIQQTSAATEEVLASVEE 472
Cdd:cd11386 154 VEETGRAFEEIVASVEEVADG--------------IQEISAATQEQSASTQEIAAAVEE 198
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
227-472 8.07e-43

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 153.60  E-value: 8.07e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    227 DINFAFEEVAVGTQSQSEMMSRSVEVLNDMEGNIEQIISQVRNASIRVDESLEISKGSVHTLRNFEANMKSLNDVVSQSG 306
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    307 IIFRDLMMQSKQINEIVDVITNISSQTSLLALNANIEAARAGEHGKGFAIVANEVLKLAEESNRSAGRIQGILKEFSNQA 386
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    387 SKVEVQVEKSERVQEECNEMLASVLTNVTDLGKFIDAINDVMREIVGHQENFQVKTTNIVKDVTHASNVIQQTSAATEEV 466
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240

                   ....*.
gi 49481103    467 LASVEE 472
Cdd:smart00283 241 SAAAEE 246
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
188-472 3.29e-35

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 135.50  E-value: 3.29e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103 188 RKAQELEETQRLIEETVVKLDSNFNCLRENMNTSMESMSDINFAFEEVAVGTQSQSEMMSRSVEVLNDMEGNIEQIISQV 267
Cdd:COG0840 110 SSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNA 189
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103 268 RNASIRVDESLEISKGSVHTLRNFEANMKSLNDVVSQSGIIFRDlmmQSKQINEIVDVITNISSQTSLLALNANIEAARA 347
Cdd:COG0840 190 KEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSE---SSQEIEEITSVINSIAEQTNLLALNAAIEAARA 266
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103 348 GEHGKGFAIVANEVLKLAEESNRSAGRIQGILKEFSNQASKVEVQVEKSERVQEECNEMLASVLTNVTDLGKFIDAINDV 427
Cdd:COG0840 267 GEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQL 346
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*
gi 49481103 428 MREIVGHQENFQVKTTNIVKDVTHASNVIQQTSAATEEVLASVEE 472
Cdd:COG0840 347 ISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEE 391
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
295-500 2.16e-29

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 114.46  E-value: 2.16e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103   295 MKSLNDVVSQSGIIFRDLMMQSKQINEIVDVITNISSQTSLLALNANIEAARAGEHGKGFAIVANEVLKLAEESNRSAGR 374
Cdd:pfam00015  18 MSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKE 97
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103   375 IQGIlkefsnqaskvevqVEKSERVQEECNEMLASVLTNVTDLGKFIDAINDVMREIVGHQENFQVKTTNIVKDVTHASN 454
Cdd:pfam00015  98 IEAL--------------IEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSA 163
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*.
gi 49481103   455 VIQQTSAATEEVLASVEEEKHRNDTSVKTLHTVSEQVKLLEDILEK 500
Cdd:pfam00015 164 GIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQ 209
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
214-491 1.19e-26

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 111.70  E-value: 1.19e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103  214 LRENMNTSMESMSDINFAFEEVAVGTQSQSEMMSRSVEVLNDMEGNIEQIISQVRNASIRVDESLEISKGSVHTlrnfea 293
Cdd:PRK09793 259 LRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATT------ 332
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103  294 nMKSLNDVVSQSGIIFRDLMMQSKQINEIVDVITNISSQTSLLALNANIEAARAGEHGKGFAIVANEVLKLAEESNRSAG 373
Cdd:PRK09793 333 -AQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAK 411
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103  374 RIQGILKEFSNQASKVEVQVEKSERVQEEcnemlasVLTNVTdlgkfidAINDVMREIVGHQENFQVKTTNIVKDVTHAS 453
Cdd:PRK09793 412 EIKGLIEESVNRVQQGSKLVNNAAATMTD-------IVSSVT-------RVNDIMGEIASASEEQRRGIEQVAQAVSQMD 477
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 49481103  454 NVIQQTSAATEEVLASVEEEKHRND--TSVKTLHTVSEQV 491
Cdd:PRK09793 478 QVTQQNASLVEEAAVATEQLANQADhlSSRVAVFTLEEHE 517
235kDa-fam TIGR01612
reticulocyte binding/rhoptry protein; This model represents a group of paralogous families in ...
176-490 1.35e-04

reticulocyte binding/rhoptry protein; This model represents a group of paralogous families in plasmodium species alternately annotated as reticulocyte binding protein, 235-kDa family protein and rhoptry protein. Rhoptry protein is localized on the cell surface and is extremely large (although apparently lacking in repeat structure) and is important for the process of invasion of the RBCs by the parasite. These proteins are found in P. falciparum, P. vivax and P. yoelii.


Pssm-ID: 130673 [Multi-domain]  Cd Length: 2757  Bit Score: 43.50  E-value: 1.35e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    176 LARLSDEKQEVMRKAQELEETQRLIEETVVKLDSN-FNCLRENMNTSMESMSDINFAFEEVAV---GTQSQSEMMSRSVE 251
Cdd:TIGR01612 2389 ITKLTEKIQDILIFVTTYENDNNIIKQHIQDNDENdVSKIKDNLKKTIQSFQEILNKIDEIKAqfyGGNNINNIIITISQ 2468
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    252 VLNDMEGNIEQIISqVRNASIRVDESLEISKGSVHTLRnfeanmkslndvvsqsgiifrdlmmqSKQINEIVDVITN-IS 330
Cdd:TIGR01612 2469 NANDVKNHFSKDLT-IENELIQIQKRLEDIKNAAHEIR--------------------------SEQITKYTNAIHNhIE 2521
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    331 SQTSLLALNANieaaragehgkgfaivANEVLKLAEesnrsagrIQGILKEFSNQASKVEVQVEKSERVQEEcnemLASV 410
Cdd:TIGR01612 2522 EQFKKIENNSN----------------KDEVYKINE--------IDNIIEKIINYNKEPEVKLHAIIDNKNE----FASI 2573
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    411 LTNVTDLGKFIDAI----NDVMREI-VGHQENFQvkttNIVKDVTHASNVIQQTSAATEEVLASVEEEKHrNDTSVKTLH 485
Cdd:TIGR01612 2574 IPDIKNLIALIESEygnnNNISYKVaIKHEEDAN----NIILDLNKSQNILNHLIHKNKKIIEDLGNIKH-GIHNNNNLH 2648

                   ....*
gi 49481103    486 TVSEQ 490
Cdd:TIGR01612 2649 TINKH 2653
 
Name Accession Description Interval E-value
DUF4077 pfam13295
Domain of unknown function (DUF4077); This is the N-terminal region of methyl-accepting ...
1-175 1.09e-111

Domain of unknown function (DUF4077); This is the N-terminal region of methyl-accepting chemotaxis proteins from Bacillus spp. The function is not known.


Pssm-ID: 205475  Cd Length: 175  Bit Score: 331.20  E-value: 1.09e-111
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103     1 MEWLKKTCFSNLEKESQKNHLLLFITICSFFLGIIAIGYYGYIFTERAIAFWVCGISVVVFGTLLTFIESMESMYKYIMT 80
Cdd:pfam13295   1 MEWLKRTCFSNLEKESQKNHLLLFITICSFFLGIIAIGYYGYIFTERAIAFWMCGISVVVFGTLLTFIESMEAMYKYIMT 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    81 FMLLMMSFIMVQAFNESPAVFQMVYFTLAVSLIYLSERLVVILGGVAVVLTFILCSYWPEQFFAYTAASEAANFASLLAI 160
Cdd:pfam13295  81 FMLLIMSFIMVQAFNESPAVFQMVYFTLAVSLIYLSERLILILGGVAVVITFILCSYWPEQFFAYTASSEAANFASLLAI 160
                         170
                  ....*....|....*
gi 49481103   161 VTIAMWGVTKIGSNL 175
Cdd:pfam13295 161 VTIAMWGVTKIGSNL 175
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
254-472 6.48e-38

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 138.14  E-value: 6.48e-38
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103 254 NDMEGNIEQIISQVRNASIRVDESLEISKGSVHTLRNFEANMKSLNDVVSQSGIIFRDLMMQSKQINEIVDVITNISSQT 333
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103 334 SLLALNANIEAARAGEHGKGFAIVANEVLKLAEESNRSAGRIQGILKEfsnqaskVEVQVEKSERVQEECNEMLASVLTN 413
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEE-------IQEQTEEAVEAMEETSEEVEEGVEL 153
                       170       180       190       200       210
                ....*....|....*....|....*....|....*....|....*....|....*....
gi 49481103 414 VTDLGKFIDAINDVMREIVGHqenfqvkttnivkdVTHASNVIQQTSAATEEVLASVEE 472
Cdd:cd11386 154 VEETGRAFEEIVASVEEVADG--------------IQEISAATQEQSASTQEIAAAVEE 198
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
227-472 8.07e-43

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 153.60  E-value: 8.07e-43
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    227 DINFAFEEVAVGTQSQSEMMSRSVEVLNDMEGNIEQIISQVRNASIRVDESLEISKGSVHTLRNFEANMKSLNDVVSQSG 306
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAV 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    307 IIFRDLMMQSKQINEIVDVITNISSQTSLLALNANIEAARAGEHGKGFAIVANEVLKLAEESNRSAGRIQGILKEFSNQA 386
Cdd:smart00283  81 SAVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEET 160
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    387 SKVEVQVEKSERVQEECNEMLASVLTNVTDLGKFIDAINDVMREIVGHQENFQVKTTNIVKDVTHASNVIQQTSAATEEV 466
Cdd:smart00283 161 NEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEVNAAIDEIAQVTQETAAMSEEI 240

                   ....*.
gi 49481103    467 LASVEE 472
Cdd:smart00283 241 SAAAEE 246
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
188-472 3.29e-35

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 135.50  E-value: 3.29e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103 188 RKAQELEETQRLIEETVVKLDSNFNCLRENMNTSMESMSDINFAFEEVAVGTQSQSEMMSRSVEVLNDMEGNIEQIISQV 267
Cdd:COG0840 110 SSNDEFGQLAKSFNEMILNLRQIIDAVQDNAEALSGASEEIAASATELSARADQQAESLEEVASAIEELSETVKEVAFNA 189
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103 268 RNASIRVDESLEISKGSVHTLRNFEANMKSLNDVVSQSGIIFRDlmmQSKQINEIVDVITNISSQTSLLALNANIEAARA 347
Cdd:COG0840 190 KEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAEVVKKLSE---SSQEIEEITSVINSIAEQTNLLALNAAIEAARA 266
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103 348 GEHGKGFAIVANEVLKLAEESNRSAGRIQGILKEFSNQASKVEVQVEKSERVQEECNEMLASVLTNVTDLGKFIDAINDV 427
Cdd:COG0840 267 GEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAAIEEVSQL 346
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*
gi 49481103 428 MREIVGHQENFQVKTTNIVKDVTHASNVIQQTSAATEEVLASVEE 472
Cdd:COG0840 347 ISEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEE 391
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
295-500 2.16e-29

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 114.46  E-value: 2.16e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103   295 MKSLNDVVSQSGIIFRDLMMQSKQINEIVDVITNISSQTSLLALNANIEAARAGEHGKGFAIVANEVLKLAEESNRSAGR 374
Cdd:pfam00015  18 MSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKE 97
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103   375 IQGIlkefsnqaskvevqVEKSERVQEECNEMLASVLTNVTDLGKFIDAINDVMREIVGHQENFQVKTTNIVKDVTHASN 454
Cdd:pfam00015  98 IEAL--------------IEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVDAVAEIADIVQEIAAASDEQSA 163
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*.
gi 49481103   455 VIQQTSAATEEVLASVEEEKHRNDTSVKTLHTVSEQVKLLEDILEK 500
Cdd:pfam00015 164 GIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQ 209
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
214-491 1.19e-26

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 111.70  E-value: 1.19e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103  214 LRENMNTSMESMSDINFAFEEVAVGTQSQSEMMSRSVEVLNDMEGNIEQIISQVRNASIRVDESLEISKGSVHTlrnfea 293
Cdd:PRK09793 259 LRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEQQAASLAQTAASMEQLTATVGQNADNARQASELAKNAATT------ 332
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103  294 nMKSLNDVVSQSGIIFRDLMMQSKQINEIVDVITNISSQTSLLALNANIEAARAGEHGKGFAIVANEVLKLAEESNRSAG 373
Cdd:PRK09793 333 -AQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAK 411
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103  374 RIQGILKEFSNQASKVEVQVEKSERVQEEcnemlasVLTNVTdlgkfidAINDVMREIVGHQENFQVKTTNIVKDVTHAS 453
Cdd:PRK09793 412 EIKGLIEESVNRVQQGSKLVNNAAATMTD-------IVSSVT-------RVNDIMGEIASASEEQRRGIEQVAQAVSQMD 477
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 49481103  454 NVIQQTSAATEEVLASVEEEKHRND--TSVKTLHTVSEQV 491
Cdd:PRK09793 478 QVTQQNASLVEEAAVATEQLANQADhlSSRVAVFTLEEHE 517
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
234-492 3.41e-21

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 95.41  E-value: 3.41e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103  234 EVAVGTQSQSEMMSRSVEVLNDMEGNIEQIISQVRNASIRVDESLEISKGSVHTLrnfEANMKSLNDVVSQsgiiFRDLM 313
Cdd:PRK15041 283 EIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETA---QRGGKVVDNVVQT----MRDIS 355
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103  314 MQSKQINEIVDVITNISSQTSLLALNANIEAARAGEHGKGFAIVANEVLKLAEESNRSAGRIQGILKEfsnQASKVEVQV 393
Cdd:PRK15041 356 TSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIED---SVGKVDVGS 432
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103  394 EKSERVQEECNEMLASVlTNVTdlgkfidainDVMREIVGHQENFQVKTTNIVKDVTHASNVIQQTSAATEE---VLASV 470
Cdd:PRK15041 433 TLVESAGETMAEIVSAV-TRVT----------DIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEEsaaAAAAL 501
                        250       260
                 ....*....|....*....|..
gi 49481103  471 EEEKHRNDTSVKTLHTVSEQVK 492
Cdd:PRK15041 502 EEQASRLTEAVAVFRIQQQQQQ 523
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
147-476 3.36e-19

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 89.30  E-value: 3.36e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103  147 AASEAANFASLLAIVTIAMW-GVTKIGSNLLARL-----------------SDEKQEVMRKAQELEETQRLIEETVvkld 208
Cdd:PRK15048 190 AQWQLAVIALVVVLILLVAWyGIRRMLLTPLAKIiahireiaggnlantltIDGRSEMGDLAQSVSHMQRSLTDTV---- 265
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103  209 snfnclrenmnTSMESMSD-INFAFEEVAVGTQSQSEMMSRSVEVLNDMEGNIEQIISQVRNASIRVDESLEISKGSVHT 287
Cdd:PRK15048 266 -----------THVREGSDaIYAGTREIAAGNTDLSSRTEQQASALEETAASMEQLTATVKQNADNARQASQLAQSASDT 334
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103  288 LRNfeaNMKSLNDVVSQsgiiFRDLMMQSKQINEIVDVITNISSQTSLLALNANIEAARAGEHGKGFAIVANEVLKLAEE 367
Cdd:PRK15048 335 AQH---GGKVVDGVVKT----MHEIADSSKKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASR 407
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103  368 SNRSAGRIQGILkefSNQASKVEVQVEKSERVQEECNEMLASVlTNVTdlgkfidainDVMREIVGHQENFQVKTTNIVK 447
Cdd:PRK15048 408 SAQAAKEIKALI---EDSVSRVDTGSVLVESAGETMNNIVNAV-TRVT----------DIMGEIASASDEQSRGIDQVAL 473
                        330       340       350
                 ....*....|....*....|....*....|..
gi 49481103  448 DVTHASNVIQQTSAATEE---VLASVEEEKHR 476
Cdd:PRK15048 474 AVSEMDRVTQQNASLVQEsaaAAAALEEQASR 505
235kDa-fam TIGR01612
reticulocyte binding/rhoptry protein; This model represents a group of paralogous families in ...
176-490 1.35e-04

reticulocyte binding/rhoptry protein; This model represents a group of paralogous families in plasmodium species alternately annotated as reticulocyte binding protein, 235-kDa family protein and rhoptry protein. Rhoptry protein is localized on the cell surface and is extremely large (although apparently lacking in repeat structure) and is important for the process of invasion of the RBCs by the parasite. These proteins are found in P. falciparum, P. vivax and P. yoelii.


Pssm-ID: 130673 [Multi-domain]  Cd Length: 2757  Bit Score: 43.50  E-value: 1.35e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    176 LARLSDEKQEVMRKAQELEETQRLIEETVVKLDSN-FNCLRENMNTSMESMSDINFAFEEVAV---GTQSQSEMMSRSVE 251
Cdd:TIGR01612 2389 ITKLTEKIQDILIFVTTYENDNNIIKQHIQDNDENdVSKIKDNLKKTIQSFQEILNKIDEIKAqfyGGNNINNIIITISQ 2468
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    252 VLNDMEGNIEQIISqVRNASIRVDESLEISKGSVHTLRnfeanmkslndvvsqsgiifrdlmmqSKQINEIVDVITN-IS 330
Cdd:TIGR01612 2469 NANDVKNHFSKDLT-IENELIQIQKRLEDIKNAAHEIR--------------------------SEQITKYTNAIHNhIE 2521
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    331 SQTSLLALNANieaaragehgkgfaivANEVLKLAEesnrsagrIQGILKEFSNQASKVEVQVEKSERVQEEcnemLASV 410
Cdd:TIGR01612 2522 EQFKKIENNSN----------------KDEVYKINE--------IDNIIEKIINYNKEPEVKLHAIIDNKNE----FASI 2573
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103    411 LTNVTDLGKFIDAI----NDVMREI-VGHQENFQvkttNIVKDVTHASNVIQQTSAATEEVLASVEEEKHrNDTSVKTLH 485
Cdd:TIGR01612 2574 IPDIKNLIALIESEygnnNNISYKVaIKHEEDAN----NIILDLNKSQNILNHLIHKNKKIIEDLGNIKH-GIHNNNNLH 2648

                   ....*
gi 49481103    486 TVSEQ 490
Cdd:TIGR01612 2649 TINKH 2653
EzrA pfam06160
Septation ring formation regulator, EzrA; During the bacterial cell cycle, the tubulin-like ...
191-457 3.52e-03

Septation ring formation regulator, EzrA; During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerizes into a ring structure that establishes the location of the nascent division site. EzrA modulates the frequency and position of FtsZ ring formation.


Pssm-ID: 253592 [Multi-domain]  Cd Length: 560  Bit Score: 38.31  E-value: 3.52e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103   191 QELEETQR-LIEE----TVVKLDSNFNCLRENMNTSMESMSDINFafEEVAVGTQSQSE-------MMSRSVEVLNDMEG 258
Cdd:pfam06160 229 EELEAGYReMTEEgyhfEHVDIEKELQDLKEQIDQNLALLEELDL--DEAEEENEEIEEridalydILEKEVKAKKFVEK 306
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103   259 NIEQI---ISQVRNASI-------RVDESLEISKGSVHTLRNFEANMKSLNDVVSQSgiifRDLMMQSKQ--------IN 320
Cdd:pfam06160 307 NIDKLtefLEHAKEQNKqllleldRLQQSYTLNHDELETVRELEKQLEELEKQYEQL----VERIAEKKVayselqeeLE 382
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103   321 EIVDVITNISSQTslLALNANIEAARAGEhgkgfaIVANEvlklaeesnrsagriqgILKEFSNQASKVEVQVEKSE--R 398
Cdd:pfam06160 383 AILKQLEEIEKEQ--EELSESLQGLRKDE------LEARE-----------------KLQEYRQKLHEIKRYLEKSNlpG 437
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 49481103   399 VQEECNEMLASVLTNVTDLGKF-------IDAINDVMREIVGHQENFQVKTTNIVKDVTHASNVIQ 457
Cdd:pfam06160 438 LPEDYLEYFFVVSDEIEALADElnevpinMDAVNRQLEEATDDVETLKEKTEELVDNATLTEQLIQ 503
Lipoprotein_7 pfam01540
Adhesin lipoprotein; This family consists of the p50 and variable adherence-associated antigen ...
154-431 7.72e-03

Adhesin lipoprotein; This family consists of the p50 and variable adherence-associated antigen (Vaa) adhesins from Mycoplasma hominis. M. hominis is a mycoplasma associated with human urogenital diseases, pneumonia, and septic arthritis. An adhesin is a cell surface molecule that mediates adhesion to other cells or to the surrounding surface or substrate. The Vaa antigen is a 50-kDa surface lipoprotein that has four tandem repetitive DNA sequences encoding a periodic peptide structure, and is highly immunogenic in the human host. p50 is also a 50-kDa lipoprotein, having three repeats A,B and C, that may be a tetramer of 191-kDa in its native environment.


Pssm-ID: 110537 [Multi-domain]  Cd Length: 353  Bit Score: 36.99  E-value: 7.72e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103   154 FASLLAIVTIAMWGVTKIGSN--LLArlsdEKQEVMRKAQELEETQRLIEEtvVKLDSNFNCLRENMNtsmesmsdinfa 231
Cdd:pfam01540   8 FITLCGIAATAILPVATISCNddKLA----EKNGKEKADAALKQANALAEE--LKKNPDYSKILETLN------------ 69
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103   232 fEEVAVGTQSQSEM------------MSRSVEVLNDMEGNIEQIISQV------RNASIRV---------DESLEISKGS 284
Cdd:pfam01540  70 -KEIAEATKSFKEAgsygdypaiiskLSAAVENAKNEKKAIDDKNAQIakelaeRNAKIQSnieelkkinNEAFELSKTV 148
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49481103   285 VHTLRNFEANMKSLNDVVSQSGIIFRDLMMQSKQINEIVDVITN--------ISSQTSLLALNAN---IEAARAGEHGKG 353
Cdd:pfam01540 149 NKTIAEVEKKFKIPKDFKEQLENFADDLLDKSRQIDEFTTVTSTqegftlaeLESFKEITTTWFNgmkSEWARVLDAWKN 228
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 49481103   354 FAIVANEVLKLAEESNRSAGRIQgilkEFSNQASKVEVQVEKSERVQEECNEMLASVLTNvtDLGKFIDAINDVMREI 431
Cdd:pfam01540 229 ELTEINSIIKGVEELKKLSHEIS----EFSNSVKKTISELEKKFKIDDKTNKEEAKKFKN--ELENFADQLLNKSHEI 300
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH