NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|45553447|ref|NP_996253|]
View 

annexin IX, isoform C [Drosophila melanogaster]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
256-321 8.00e-26

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


:

Pssm-ID: 249668  Cd Length: 66  Bit Score: 98.29  E-value: 8.00e-26
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 45553447   256 YFSERLHDSMAGMGTKDKTLIRIIVSRSEIDLGDIKEAFQNKYGKSLESWIKGDTSGDYKRALLAI 321
Cdd:pfam00191   1 YDAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKRYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
25-90 3.73e-25

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


:

Pssm-ID: 249668  Cd Length: 66  Bit Score: 96.36  E-value: 3.73e-25
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 45553447    25 EDAAILRKAMKGFGTDEKAIIEILARRGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFEDVILAL 90
Cdd:pfam00191   1 YDAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKRYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
97-162 1.71e-23

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


:

Pssm-ID: 249668  Cd Length: 66  Bit Score: 91.74  E-value: 1.71e-23
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 45553447    97 FYAQELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGDTSGHFKRLCVSL 162
Cdd:pfam00191   1 YDAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKRYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
185-246 1.00e-19

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


:

Pssm-ID: 249668  Cd Length: 66  Bit Score: 80.95  E-value: 1.00e-19
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 45553447   185 LHDAgEGQWGTDESTFNSILITRSYQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAI 246
Cdd:pfam00191   6 LRAA-MKGLGTDEDTLIRILATRSNAQLQAIREAYKKRYGKDLEKDIKSETSGDFEKLLLAL 66
 
Name Accession Description Interval E-value
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
256-321 8.00e-26

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 249668  Cd Length: 66  Bit Score: 98.29  E-value: 8.00e-26
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 45553447   256 YFSERLHDSMAGMGTKDKTLIRIIVSRSEIDLGDIKEAFQNKYGKSLESWIKGDTSGDYKRALLAI 321
Cdd:pfam00191   1 YDAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKRYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
25-90 3.73e-25

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 249668  Cd Length: 66  Bit Score: 96.36  E-value: 3.73e-25
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 45553447    25 EDAAILRKAMKGFGTDEKAIIEILARRGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFEDVILAL 90
Cdd:pfam00191   1 YDAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKRYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
97-162 1.71e-23

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 249668  Cd Length: 66  Bit Score: 91.74  E-value: 1.71e-23
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 45553447    97 FYAQELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGDTSGHFKRLCVSL 162
Cdd:pfam00191   1 YDAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKRYGKDLEKDIKSETSGDFEKLLLAL 66
ANX smart00335
Annexin repeats;
269-321 2.77e-22

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 87.85  E-value: 2.77e-22
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 45553447    269 GTKDKTLIRIIVSRSEIDLGDIKEAFQNKYGKSLESWIKGDTSGDYKRALLAI 321
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
ANX smart00335
Annexin repeats;
38-90 5.73e-20

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 81.30  E-value: 5.73e-20
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 45553447     38 GTDEKAIIEILARRGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFEDVILAL 90
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
185-246 1.00e-19

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 249668  Cd Length: 66  Bit Score: 80.95  E-value: 1.00e-19
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 45553447   185 LHDAgEGQWGTDESTFNSILITRSYQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAI 246
Cdd:pfam00191   6 LRAA-MKGLGTDEDTLIRILATRSNAQLQAIREAYKKRYGKDLEKDIKSETSGDFEKLLLAL 66
ANX smart00335
Annexin repeats;
110-162 7.05e-19

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 78.60  E-value: 7.05e-19
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 45553447    110 GTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGDTSGHFKRLCVSL 162
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
ANX smart00335
Annexin repeats;
194-246 7.84e-17

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 72.83  E-value: 7.84e-17
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 45553447    194 GTDESTFNSILITRSYQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAI 246
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
 
Name Accession Description Interval E-value
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
256-321 8.00e-26

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 249668  Cd Length: 66  Bit Score: 98.29  E-value: 8.00e-26
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 45553447   256 YFSERLHDSMAGMGTKDKTLIRIIVSRSEIDLGDIKEAFQNKYGKSLESWIKGDTSGDYKRALLAI 321
Cdd:pfam00191   1 YDAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKRYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
25-90 3.73e-25

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 249668  Cd Length: 66  Bit Score: 96.36  E-value: 3.73e-25
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 45553447    25 EDAAILRKAMKGFGTDEKAIIEILARRGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFEDVILAL 90
Cdd:pfam00191   1 YDAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKRYGKDLEKDIKSETSGDFEKLLLAL 66
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
97-162 1.71e-23

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 249668  Cd Length: 66  Bit Score: 91.74  E-value: 1.71e-23
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 45553447    97 FYAQELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGDTSGHFKRLCVSL 162
Cdd:pfam00191   1 YDAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKRYGKDLEKDIKSETSGDFEKLLLAL 66
ANX smart00335
Annexin repeats;
269-321 2.77e-22

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 87.85  E-value: 2.77e-22
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 45553447    269 GTKDKTLIRIIVSRSEIDLGDIKEAFQNKYGKSLESWIKGDTSGDYKRALLAI 321
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
ANX smart00335
Annexin repeats;
38-90 5.73e-20

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 81.30  E-value: 5.73e-20
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 45553447     38 GTDEKAIIEILARRGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFEDVILAL 90
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
Annexin pfam00191
Annexin; This family of annexins also includes giardin that has been shown to function as an ...
185-246 1.00e-19

Annexin; This family of annexins also includes giardin that has been shown to function as an annexin.


Pssm-ID: 249668  Cd Length: 66  Bit Score: 80.95  E-value: 1.00e-19
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 45553447   185 LHDAgEGQWGTDESTFNSILITRSYQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAI 246
Cdd:pfam00191   6 LRAA-MKGLGTDEDTLIRILATRSNAQLQAIREAYKKRYGKDLEKDIKSETSGDFEKLLLAL 66
ANX smart00335
Annexin repeats;
110-162 7.05e-19

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 78.60  E-value: 7.05e-19
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 45553447    110 GTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGDTSGHFKRLCVSL 162
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
ANX smart00335
Annexin repeats;
194-246 7.84e-17

Annexin repeats;


Pssm-ID: 197661  Cd Length: 53  Bit Score: 72.83  E-value: 7.84e-17
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|...
gi 45553447    194 GTDESTFNSILITRSYQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAI 246
Cdd:smart00335   1 GTDEKTLIEILASRSNAQLQAIKQAYKKRYGKDLEDDIKSETSGDFEKLLLAL 53
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH