NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4502995|ref|NP_003562.1|]
View 

phakinin

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Filament pfam00038
Intermediate filament protein;
115-414 2.22e-55

Intermediate filament protein;


:

Pssm-ID: 200948 [Multi-domain]  Cd Length: 312  Bit Score: 187.02  E-value: 2.22e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    115 LVEYMAKVHALEQVSQELETQLRMHLESKATR-SGNWGALRASWASSCQQVGEAVLENARLMLQTETIQAGADDFKERYE 193
Cdd:pfam00038  13 LASYIDKVRFLEQQNKELEAKIEELRQKKSAEpSRLYSLYEQEIRELRKQLDELTNERARLQLEIDNLRLAAEDFREKYE 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    194 NEQPFRKAAEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLLHKQLAGCELEQMDAPIGTGLDDILE 273
Cdd:pfam00038  93 DELNLRQSAENDIVGLRKDLDEATLARVDLEMKIESLQEELAFLKKNHEEEVRELQSQIQGQVNVEMDAARKLDLTKALA 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    274 TIRIQWERDVEKNRVEAGALLQAKqQAEVAHMSQTQEEKLAAAlRVELHNTSCQVQSLQAETESLRALKRGLENTLHDAK 353
Cdd:pfam00038 173 EIRAQYEELAEKNRQEAEEWYKSK-LEELQQAAARNGDALRSA-KEEITELRRQIQSLEIELQSLKKQKASLERQLAELE 250
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 4502995    354 HWHDMELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVASYHALLDREES 414
Cdd:pfam00038 251 ERYELELADYQDTISELEEELQQLKAEMARQLREYQELLDVKLALDIEIATYRKLLEGEES 311
 
Name Accession Description Interval E-value
Filament pfam00038
Intermediate filament protein;
115-414 2.22e-55

Intermediate filament protein;


Pssm-ID: 200948 [Multi-domain]  Cd Length: 312  Bit Score: 187.02  E-value: 2.22e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    115 LVEYMAKVHALEQVSQELETQLRMHLESKATR-SGNWGALRASWASSCQQVGEAVLENARLMLQTETIQAGADDFKERYE 193
Cdd:pfam00038  13 LASYIDKVRFLEQQNKELEAKIEELRQKKSAEpSRLYSLYEQEIRELRKQLDELTNERARLQLEIDNLRLAAEDFREKYE 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    194 NEQPFRKAAEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLLHKQLAGCELEQMDAPIGTGLDDILE 273
Cdd:pfam00038  93 DELNLRQSAENDIVGLRKDLDEATLARVDLEMKIESLQEELAFLKKNHEEEVRELQSQIQGQVNVEMDAARKLDLTKALA 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    274 TIRIQWERDVEKNRVEAGALLQAKqQAEVAHMSQTQEEKLAAAlRVELHNTSCQVQSLQAETESLRALKRGLENTLHDAK 353
Cdd:pfam00038 173 EIRAQYEELAEKNRQEAEEWYKSK-LEELQQAAARNGDALRSA-KEEITELRRQIQSLEIELQSLKKQKASLERQLAELE 250
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 4502995    354 HWHDMELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVASYHALLDREES 414
Cdd:pfam00038 251 ERYELELADYQDTISELEEELQQLKAEMARQLREYQELLDVKLALDIEIATYRKLLEGEES 311
PRK02224 PRK02224
chromosome segregation protein; Provisional
185-387 8.88e-07

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 49.65  E-value: 8.88e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   185 ADDFKERYENEQpfrkaaeEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLLHKQLAGCELEQMDAPI 264
Cdd:PRK02224 239 ADEVLEEHEERR-------EELETLEAEIEDLRETIAETEREREELAEEVRDLRERLEELEEERDDLLAEAGLDDADAEA 311
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   265 GTGLDDILETIRIQWERDVEKNRVEAGALL-QAKQQAEVAHMSQTQEEKL---AAALRVELHNTSCQVQS-------LQA 333
Cdd:PRK02224 312 VEARREELEDRDEELRDRLEECRVAAQAHNeEAESLREDADDLEERAEELreeAAELESELEEAREAVEDrreeieeLEE 391
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   334 ETESLRALKRGLENTLHDAKHWHDMELQNLGAVVGR---LEAELREIR---AEAEQQQQE 387
Cdd:PRK02224 392 EIEELRERFGDAPVDLGNAEDFLEELREERDELREReaeLEATLRTARervEEAEALLEA 451
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
120-386 1.32e-06

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 49.28  E-value: 1.32e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     120 AKVHALEQVSQELETQLRMHLESKATRSGNWGALRASWASSCQQVGEAVLENARLMLQTETIQAGADDFKERYENEQPFR 199
Cdd:TIGR02168  698 KALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAEEEL 777
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     200 KAAEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRNY---EEDVKLLHKQLAGCELEqmdapigtglddiLETIR 276
Cdd:TIGR02168  778 AEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAanlRERLESLERRIAATERR-------------LEDLE 844
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     277 IQWERdvEKNRVEAGALLQAKQQAEVAhmsqTQEEKLAAALrVELHNTSCQVQSLQAETESLRALKRGLENTLHDAKHwh 356
Cdd:TIGR02168  845 EQIEE--LSEDIESLAAEIEELEELIE----ELESELEALL-NERASLEEALALLRSELEELSEELRELESKRSELRR-- 915
                          250       260       270
                   ....*....|....*....|....*....|
gi 4502995     357 dmELQNLGAVVGRLEAELREIRAEAEQQQQ 386
Cdd:TIGR02168  916 --ELEELREKLAQLELRLEGLEVRIDNLQE 943
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
185-405 2.61e-06

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 48.56  E-value: 2.61e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   185 ADDFKERYENEQPFRKAaEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLLhKQLAGcELEQMDAPI 264
Cdd:COG1196  670 KELEEELAELEAQLEKL-EEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEEL-EQLQS-RLEELEEEL 746
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   265 GTgLDDILETIRIQWERDVEKNR--VEAGALLQAKQQaEVAHMSQTQEEKLaAALRVELHNTSCQVQSLQAETESLRALK 342
Cdd:COG1196  747 EE-LEEELEELQERLEELEEELEslEEALAKLKEEIE-ELEEKRQALQEEL-EELEEELEEAERRLDALERELESLEQRR 823
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 4502995   343 RGLENTLHDAKHwhdmELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVASY 405
Cdd:COG1196  824 ERLEQEIEELEE----EIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKEL 882
 
Name Accession Description Interval E-value
Filament pfam00038
Intermediate filament protein;
115-414 2.22e-55

Intermediate filament protein;


Pssm-ID: 200948 [Multi-domain]  Cd Length: 312  Bit Score: 187.02  E-value: 2.22e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    115 LVEYMAKVHALEQVSQELETQLRMHLESKATR-SGNWGALRASWASSCQQVGEAVLENARLMLQTETIQAGADDFKERYE 193
Cdd:pfam00038  13 LASYIDKVRFLEQQNKELEAKIEELRQKKSAEpSRLYSLYEQEIRELRKQLDELTNERARLQLEIDNLRLAAEDFREKYE 92
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    194 NEQPFRKAAEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLLHKQLAGCELEQMDAPIGTGLDDILE 273
Cdd:pfam00038  93 DELNLRQSAENDIVGLRKDLDEATLARVDLEMKIESLQEELAFLKKNHEEEVRELQSQIQGQVNVEMDAARKLDLTKALA 172
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    274 TIRIQWERDVEKNRVEAGALLQAKqQAEVAHMSQTQEEKLAAAlRVELHNTSCQVQSLQAETESLRALKRGLENTLHDAK 353
Cdd:pfam00038 173 EIRAQYEELAEKNRQEAEEWYKSK-LEELQQAAARNGDALRSA-KEEITELRRQIQSLEIELQSLKKQKASLERQLAELE 250
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 4502995    354 HWHDMELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVASYHALLDREES 414
Cdd:pfam00038 251 ERYELELADYQDTISELEEELQQLKAEMARQLREYQELLDVKLALDIEIATYRKLLEGEES 311
PRK02224 PRK02224
chromosome segregation protein; Provisional
185-387 8.88e-07

chromosome segregation protein; Provisional


Pssm-ID: 179385 [Multi-domain]  Cd Length: 880  Bit Score: 49.65  E-value: 8.88e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   185 ADDFKERYENEQpfrkaaeEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLLHKQLAGCELEQMDAPI 264
Cdd:PRK02224 239 ADEVLEEHEERR-------EELETLEAEIEDLRETIAETEREREELAEEVRDLRERLEELEEERDDLLAEAGLDDADAEA 311
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   265 GTGLDDILETIRIQWERDVEKNRVEAGALL-QAKQQAEVAHMSQTQEEKL---AAALRVELHNTSCQVQS-------LQA 333
Cdd:PRK02224 312 VEARREELEDRDEELRDRLEECRVAAQAHNeEAESLREDADDLEERAEELreeAAELESELEEAREAVEDrreeieeLEE 391
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   334 ETESLRALKRGLENTLHDAKHWHDMELQNLGAVVGR---LEAELREIR---AEAEQQQQE 387
Cdd:PRK02224 392 EIEELRERFGDAPVDLGNAEDFLEELREERDELREReaeLEATLRTARervEEAEALLEA 451
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
120-386 1.32e-06

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 49.28  E-value: 1.32e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     120 AKVHALEQVSQELETQLRMHLESKATRSGNWGALRASWASSCQQVGEAVLENARLMLQTETIQAGADDFKERYENEQPFR 199
Cdd:TIGR02168  698 KALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEAEVEQLEERIAQLSKELTELEAEIEELEERLEEAEEEL 777
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     200 KAAEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRNY---EEDVKLLHKQLAGCELEqmdapigtglddiLETIR 276
Cdd:TIGR02168  778 AEAEAEIEELEAQIEQLKEELKALREALDELRAELTLLNEEAanlRERLESLERRIAATERR-------------LEDLE 844
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     277 IQWERdvEKNRVEAGALLQAKQQAEVAhmsqTQEEKLAAALrVELHNTSCQVQSLQAETESLRALKRGLENTLHDAKHwh 356
Cdd:TIGR02168  845 EQIEE--LSEDIESLAAEIEELEELIE----ELESELEALL-NERASLEEALALLRSELEELSEELRELESKRSELRR-- 915
                          250       260       270
                   ....*....|....*....|....*....|
gi 4502995     357 dmELQNLGAVVGRLEAELREIRAEAEQQQQ 386
Cdd:TIGR02168  916 --ELEELREKLAQLELRLEGLEVRIDNLQE 943
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
185-405 2.61e-06

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 48.56  E-value: 2.61e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   185 ADDFKERYENEQPFRKAaEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLLhKQLAGcELEQMDAPI 264
Cdd:COG1196  670 KELEEELAELEAQLEKL-EEELKSLKNELRSLEDLLEELRRQLEELERQLEELKRELAALEEEL-EQLQS-RLEELEEEL 746
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   265 GTgLDDILETIRIQWERDVEKNR--VEAGALLQAKQQaEVAHMSQTQEEKLaAALRVELHNTSCQVQSLQAETESLRALK 342
Cdd:COG1196  747 EE-LEEELEELQERLEELEEELEslEEALAKLKEEIE-ELEEKRQALQEEL-EELEEELEEAERRLDALERELESLEQRR 823
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 4502995   343 RGLENTLHDAKHwhdmELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVASY 405
Cdd:COG1196  824 ERLEQEIEELEE----EIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKEL 882
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
162-414 3.90e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 47.76  E-value: 3.90e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     162 QQVGEAVLENARLMLQTETIQAGADDFKERYENEQPFRKAAEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRny 241
Cdd:TIGR02169  709 QELSDASRKIGEIEKEIEQLEQEEEKLKERLEELEEDLSSLEQEIENVKSELKELEARIEELEEDLHKLEEALNDLEA-- 786
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     242 eedvKLLHKQLagceleqmdaPIGTGLDDILETIRIQWERDVEKNRVEAGALLQAKQQAE------VAHMSQTQEEKlaA 315
Cdd:TIGR02169  787 ----RLSHSRI----------PEIQAELSKLEEEVSRIEARLREIEQKLNRLTLEKEYLEkeiqelQEQRIDLKEQI--K 850
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     316 ALRVELHNTSCQVQSLQAETESLRALKRGLENTLHDAKHwhdmELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARK 395
Cdd:TIGR02169  851 SIEKEIENLNGKKEELEEELEELEAALRDLESRLGDLKK----ERDELEAQLRELERKIEELEAQIEKKRKRLSELKAKL 926
                          250
                   ....*....|....*....
gi 4502995     396 CQLQKDVASYHALLDREES 414
Cdd:TIGR02169  927 EALEEELSEIEDPKGEDEE 945
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
130-414 6.56e-06

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274008 [Multi-domain]  Cd Length: 1179  Bit Score: 46.97  E-value: 6.56e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     130 QELETQLR-MHLESKATRsgnWGALRASWASSCQQVGEAVLENARLMLQTETIQAGADDFKERYENeqpfrkaAEEEINS 208
Cdd:TIGR02168  216 KELKAELReLELALLVLR---LEELREELEELQEELKEAEEELEELTAELQELEEKLEELRLEVSE-------LEEEIEE 285
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     209 LYKVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLL-----HKQLAGCELEQMDAPIGTglddiLETIRIQWERDV 283
Cdd:TIGR02168  286 LQKELYALANEISRLEQQKQILRERLANLERQLEELEAQLeelesKLDELAEELAELEEKLEE-----LKEELESLEAEL 360
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     284 EKNRVEAGALLQAKQQAEVAHMSQTQEEKLA----AALRVELHNTSCQVQSLQAETESLRALKRGLENTLHDA-KHWHDM 358
Cdd:TIGR02168  361 EELEAELEELESRLEELEEQLETLRSKVAQLelqiASLNNEIERLEARLERLEDRRERLQQEIEELLKKLEEAeLKELQA 440
                          250       260       270       280       290
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 4502995     359 ELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVASYHALLDREES 414
Cdd:TIGR02168  441 ELEELEEELEELQEELERLEEALEELREELEEAEQALDAAERELAQLQARLDSLER 496
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
177-405 8.80e-06

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 46.60  E-value: 8.80e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     177 QTETIQAGADDFKERYENEQPFRKAAEEEINSLYKVIDEANLTKMDL-ESQIESLKEELGSLsrnyEEDVKLLHKQLAGC 255
Cdd:TIGR02169  238 QKEAIERQLASLEEELEKLTEEISELEKRLEEIEQLLEELNKKIKDLgEEEQLRVKEKIGEL----EAEIASLERSIAEK 313
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     256 ELEQMDAP-----IGTGLDDILETIRiQWERDVEKNRVEAGAL---LQAKQQAEVAHMSQTQE-EKLAAALRVELHNTSC 326
Cdd:TIGR02169  314 ERELEDAEerlakLEAEIDKLLAEIE-ELEREIEEERKRRDKLteeYAELKEELEDLRAELEEvDKEFAETRDELKDYRE 392
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 4502995     327 QVQSLQAETESLralkRGLENTLHDAKHWHDMELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVASY 405
Cdd:TIGR02169  393 KLEKLKREINEL----KRELDRLQEELQRLSEELADLNAAIAGIEAKINELEEEKEDKALEIKKQEWKLEQLAADLSKY 467
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
169-414 1.52e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 42.78  E-value: 1.52e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   169 LENARLMLQTETIQAGADDFKERYENEQPFRKAAEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLL 248
Cdd:COG1196  218 LKAELRELELALLLAKLKELRKELEELEEELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEI 297
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   249 HKQLAgcELEQMDAPIGTGLDDILET----IRIQWERDVEKNRVEAGALLQAKQQAEVA--HMSQTQEEKLAAALRVELH 322
Cdd:COG1196  298 EELEG--EISLLRERLEELENELEELeerlEELKEKIEALKEELEERETLLEELEQLLAelEEAKEELEEKLSALLEELE 375
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   323 NTscqVQSLQAETESLRALKRGLENTLHDAKHwhdmELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDV 402
Cdd:COG1196  376 EL---FEALREELAELEAELAEIRNELEELKR----EIESLEERLERLSERLEDLKEELKELEAELEELQTELEELNEEL 448
                        250
                 ....*....|..
gi 4502995   403 ASYHALLDREES 414
Cdd:COG1196  449 EELEEQLEELRD 460
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
121-404 1.67e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 42.39  E-value: 1.67e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   121 KVHALEQVSQELETQLRMHLESKATRSGNWGALRASWASSCQQVGEAVLENARLMLQTETIQAGADDFKERYENEQPFRK 200
Cdd:COG1196  696 ELRSLEDLLEELRRQLEELERQLEELKRELAALEEELEQLQSRLEELEEELEELEEELEELQERLEELEEELESLEEALA 775
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   201 AAEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSR---NYEEDVKLLHKQLAGCELEQmdapigtglddiletiri 277
Cdd:COG1196  776 KLKEEIEELEEKRQALQEELEELEEELEEAERRLDALEReleSLEQRRERLEQEIEELEEEI------------------ 837
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   278 qwerdveknrveagALLQAKQQAEVAHMSQTQEEKLAAALRVELHNTscQVQSLQAETESLRALKRGLENTLHDAKHwhd 357
Cdd:COG1196  838 --------------EELEEKLDELEEELEELEKELEELKEELEELEA--EKEELEDELKELEEEKEELEEELRELES--- 898
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 4502995   358 mELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVAS 404
Cdd:COG1196  899 -ELAELKEEIEKLRERLEELEAKLERLEVELPELEEELEEEYEDTLE 944
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
101-343 2.05e-04

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 42.39  E-value: 2.05e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   101 LERDHGAVEDLGGCLVEYMAKVHALEQVSQELETQLRMHLESKATRSGNWGALRASWASSC----QQVGEAVLENARLML 176
Cdd:COG1196  763 LEEELESLEEALAKLKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRerleQEIEELEEEIEELEE 842
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   177 QTETIQAGADDFKERYENEQPFRKAAEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLLHKQLAGCE 256
Cdd:COG1196  843 KLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRELESELAELKEEIEKLRERLEELEAKLE 922
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   257 -LEQMDAPIGTGLDDILE-TIRIQWERDVEKNRVEAGAL----LQAKQQAEvahmsqtQEEKLAAALRVELHNTSCQVQS 330
Cdd:COG1196  923 rLEVELPELEEELEEEYEdTLETELEREIERLEEEIEALgpvnLRAIEEYE-------EVEERYEELKSQREDLEEAKEK 995
                        250
                 ....*....|...
gi 4502995   331 LQAETESLRALKR 343
Cdd:COG1196  996 LLEVIEELDKEKR 1008
SbcC COG0419
DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];
188-414 2.88e-04

DNA repair exonuclease SbcCD ATPase subunit [Replication, recombination and repair];


Pssm-ID: 223496 [Multi-domain]  Cd Length: 908  Bit Score: 41.67  E-value: 2.88e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995  188 FKERYENEQPFRKAAEEEINSLY---KVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLLHKQLAgceleqmdapi 264
Cdd:COG0419 145 FDAFLKSKPKERKEILDELFGLEkyeKLSELLKEVIKEAKAKIEELEGQLSELLEDIEDLLEALEEELK----------- 213
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995  265 gtgLDDILETIRIQWERDVEKNRVEAgallQAKQQAEVAHMSQTQEEKLAAALRVElhntSCQVQSLQAETESLRALKRG 344
Cdd:COG0419 214 ---ELKKLEEIQEEQEEEELEQEIEA----LEERLAELEEEKERLEELKARLLEIE----SLELEALKIREEELRELERL 282
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995  345 LEntlhdAKHWHDMELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVASYHALLDREES 414
Cdd:COG0419 283 LE-----ELEEKIERLEELEREIEELEEELEGLRALLEELEELLEKLKSLEERLEKLEEKLEKLESELEE 347
SCP-1 pfam05483
Synaptonemal complex protein 1 (SCP-1); Synaptonemal complex protein 1 (SCP-1) is the major ...
109-348 3.63e-04

Synaptonemal complex protein 1 (SCP-1); Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex. Synaptonemal complexes are structures that are formed between homologous chromosomes during meiotic prophase.


Pssm-ID: 114219 [Multi-domain]  Cd Length: 787  Bit Score: 41.25  E-value: 3.63e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    109 EDLGGCLVEYMAKVHALEQVsQELETQLRMHLESKATRSGNWG-ALRASWASSCQQVGEAVLENARLMLQTETIQAGADD 187
Cdd:pfam05483 520 EDIINCKKQEERMLKQIENL-EEKEMNLRDELESVREEFIQKGdEVKCKLDKSEENARSIEYEVLKKEKQMKILENKCNN 598
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    188 FKERYENEQPFRKAAEEEINSLYKV---------IDEANLTKMDLEsqIESLKEELGSLSRNYE---EDVKLLHKQLAGc 255
Cdd:pfam05483 599 LKKQIENKNKNIEELHQENKALKKKgsaenkqlnAYEIKVNKLELE--LASAKQKFEEIIDNYQkeiEDKKISEEKLLE- 675
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    256 ELEQMDAPIGtglddilETIRIQWERD-------------VEKNRVEAGALLQAKQQAEVAHMSQTQEEK-LAAALRVEL 321
Cdd:pfam05483 676 EVEKAKAIAD-------EAVKLQKEIDkrcqhkiaemvalMEKHKHQYDKIIEERDSELGLYKNKEQEQSsAKAALEIEL 748
                         250       260       270
                  ....*....|....*....|....*....|..
gi 4502995    322 HNTSCQVQSLQAETESLRALKRGL-----ENT 348
Cdd:pfam05483 749 SNIKAELLSLKKQLEIEKEEKEKLkmeakENT 780
EnvC COG4942
Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, ...
199-404 7.69e-04

Septal ring factor EnvC, activator of murein hydrolases AmiA and AmiB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 227278 [Multi-domain]  Cd Length: 420  Bit Score: 40.09  E-value: 7.69e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995  199 RKAAEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLLHKQLAGCELEQMDAPIGTGL--DDILETIR 276
Cdd:COG4942  68 LKSLETEIASLEAQLIETADDLKKLRKQIADLNARLNALEVQEREQRRRLAEQLAALQRSGRNPPPALLVspEDAQRSVR 147
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995  277 I-QWERDVEKNRVEAGALLqAKQQAEVAHMSQTqeeklAAALRVELHNTSCQVQSLQAETESLRALKRGLENTLHDAKHW 355
Cdd:COG4942 148 LaIYYGALNPARAERIDAL-KATLKQLAAVRAE-----IAAEQAELTTLLSEQRAQQAKLAQLLEERKKTLAQLNSELSA 221
                       170       180       190       200
                ....*....|....*....|....*....|....*....|....*....
gi 4502995  356 HDMELQNLGAVVGRLEAELREIRAEAEQQQQERAhllARKCQLQKDVAS 404
Cdd:COG4942 222 DQKKLEELRANESRLKNEIASAEAAAAKAREAAA---AAEAAAARARAA 267
SMC_prok_A TIGR02169
chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of ...
183-414 1.06e-03

chromosome segregation protein SMC, primarily archaeal type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]


Pssm-ID: 274009 [Multi-domain]  Cd Length: 1164  Bit Score: 40.05  E-value: 1.06e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     183 AGADDFKERYEneqpfrkAAEEEINSLYKVIDEANLTKMDLESQIESLKEE---------LGSLSRNYEEDVKLLHKQLA 253
Cdd:TIGR02169  163 AGVAEFDRKKE-------KALEELEEVEENIERLDLIIDEKRQQLERLRRErekaeryqaLLKEKREYEGYELLKEKEAL 235
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     254 GCELEQMDAPIgtgldDILETIRIQWERDVEKNRVEAGALLQAKQQAEVAHMSQTQEEKLAaaLRVELHntscqvqSLQA 333
Cdd:TIGR02169  236 ERQKEAIERQL-----ASLEEELEKLTEEISELEKRLEEIEQLLEELNKKIKDLGEEEQLR--VKEKIG-------ELEA 301
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     334 ETESLRALKRGLENTLHDAkhwhDMELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARkcqLQKDVASYHALLDREE 413
Cdd:TIGR02169  302 EIASLERSIAEKERELEDA----EERLAKLEAEIDKLLAEIEELEREIEEERKRRDKLTEE---YAELKEELEDLRAELE 374

                   .
gi 4502995     414 S 414
Cdd:TIGR02169  375 E 375
Smc COG1196
Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];
183-414 1.68e-03

Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 224117 [Multi-domain]  Cd Length: 1163  Bit Score: 39.31  E-value: 1.68e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   183 AGADDFKERYENEQPFRKAAEEEINSLYKVIDEanltkmdLESQIESLKEELgslsrnyeEDVKLLHKQLAgcELEQMDA 262
Cdd:COG1196  165 AGVSKYKERKEEAERKLERTEENLERLEDLLEE-------LEKQLEKLERQA--------EKAERYQELKA--ELRELEL 227
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995   263 PIgtgLDDILETIRIQWERDVEknrveagALLQAKQQAEVAHMSQTQEEKLAAALRVELHNTSCQVQSLQAETESLRALK 342
Cdd:COG1196  228 AL---LLAKLKELRKELEELEE-------ELSRLEEELEELQEELEEAEKEIEELKSELEELREELEELQEELLELKEEI 297
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 4502995   343 RGLENTLHDAKhwhdMELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVASYHALLDREES 414
Cdd:COG1196  298 EELEGEISLLR----ERLEELENELEELEERLEELKEKIEALKEELEERETLLEELEQLLAELEEAKEELEE 365
DUF3584 pfam12128
Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. ...
178-411 1.70e-03

Protein of unknown function (DUF3584); This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. This family contains a P-loop motif suggesting it is a nucleotide binding protein. It may be involved in replication.


Pssm-ID: 256862 [Multi-domain]  Cd Length: 1198  Bit Score: 39.29  E-value: 1.70e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     178 TETIQAGADDFKERYENEQPFRKAAEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRnyeedvkllHKQLAGCEL 257
Cdd:pfam12128  602 ETELRERLQQAEEALQSAVAKQKQAEEQLVQANAELEEQKRAEAEARTALKQARLDLQRLQN---------EQQSLKDKL 672
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995     258 EQMdapigtglddiLETIRIQWERDVEKNRVEAGALLQAKQQAEVAHMSQTQEEKLA--AALRVELHNTSCQVQSLQAET 335
Cdd:pfam12128  673 ELA-----------IAERKQQAETQLRQLDAQLKQLLEQQQAFLEALKDDFRELRTErlAKWQVVEGELDNQLAQLSAAI 741
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 4502995     336 ESLRAlkrGLENTLHDAKHWHDMELQNLG---AVVGRLEAELREIRAEAEQQQQERAHLLARKCQLQKDVASYHALLDR 411
Cdd:pfam12128  742 EAART---QAKARLKELKKQYDRELASLDvdpNTVKELKRQIEELETTIERIAVRRPEVREYRAFMQETWLHRDSLREE 817
COG1579 COG1579
Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function ...
170-391 3.09e-03

Predicted nucleic acid-binding protein, contains Zn-ribbon domain [General function prediction only];


Pssm-ID: 224495 [Multi-domain]  Cd Length: 239  Bit Score: 37.73  E-value: 3.09e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995  170 ENARLMLQTETIQAGADDFKERYENEQPFRKAAEEEINSLYKVIDEANLTKMDLESQIESLKEELGSLSRNYEEDVKLLh 249
Cdd:COG1579   4 NNLKSLLAIQKLDLEKDRLEPRIKEIRKALKKAKAELEALNKALEALEIELEDLENQVSQLESEIQEIRERIKRAEEKL- 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995  250 kqlagceleqmdapigtglddiletiriqwerDVEKNRVEAGALLQAKQQAEvahmsqtqeeKLAAALRVELHNTSCQVQ 329
Cdd:COG1579  83 --------------------------------SAVKDERELRALNIEIQIAK----------ERINSLEDELAELMEEIE 120
                       170       180       190       200       210       220
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 4502995  330 SLQAETESLRALKRGLENTLHDAKHwhdmelqnlgavvgRLEAELREIRAEAEQQQQERAHL 391
Cdd:COG1579 121 KLEKEIEDLKERLERLEKNLAEAEA--------------RLEEEVAEIREEGQELSSKREEL 168
Myosin_tail_1 pfam01576
Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and ...
172-415 8.09e-03

Myosin tail; The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament.


Pssm-ID: 144972 [Multi-domain]  Cd Length: 859  Bit Score: 36.94  E-value: 8.09e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    172 ARLMLQTETIQAGADDFKERYENEQPFRKAAE-------EEINSLYKVIDEANLTKmdlESQIESLK---EELGSLSRNY 241
Cdd:pfam01576  35 AQLQKKIKELEARIRELEEELEAERAARAKAEkaradlsRELEELSERLEEAGGAT---AAQIELNKkreAELAKLRKDL 111
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    242 EEDVKLLHKQLAGCELEQMDA--PIGTGLDDI------LETIRIQWERDVEKNRVEAGALLQAKQQAEvaHMSQTQEEKL 313
Cdd:pfam01576 112 EEANLQHEEALATLRKKHQDAinELSEQIEQLqkqkakAEKEKSQLQAEVDDLLAQLDQIAKAKLNAE--KKAKQLESQL 189
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502995    314 AAaLRVELHNTSCQVQSLQAETESLRALKRGLENTLHDAKHwhdmELQNLGAVVGRLEAELREIRAEAEQQQQERAHLLA 393
Cdd:pfam01576 190 SE-LQVKLDELQRQLNDLTSQKSRLQSENSDLTRQLEEAEA----QVSNLSKLKSQLESQLEEAKRSLEEESRERANLQA 264
                         250       260
                  ....*....|....*....|..
gi 4502995    394 RKCQLQKDVASYHALLDREESG 415
Cdd:pfam01576 265 QLRQLEHDLDSLREQLEEESEA 286
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH