NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4502333|ref|NP_000698|]
View 

vasopressin V1b receptor [Homo sapiens]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_4 super family cl21561
Olfactory receptor; The members of this family are transmembrane olfactory receptors.
52-222 1.21e-03

Olfactory receptor; The members of this family are transmembrane olfactory receptors.


The actual alignment was detected with superfamily member pfam10328:

Pssm-ID: 304433  Cd Length: 274  Bit Score: 39.10  E-value: 1.21e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333     52 NLAVLLTLGQLGRKRSRMHLFVLHLALTD---LAVALFQVLPQLLWDITYrfqGPDLLCraVKYLQVLSMFA---STYML 125
Cdd:pfam10328  11 NWLIFYIFLKLPSLKNSFGILCANKAISNaiiCTIFLFYVVPMTLLDLSF---LPELLN--SHIGGLVLLGLyeiSPLTH 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333    126 LAMTLDRYLAVCHPLRSLQQPGQS-TYLLIAAPWLLAAIFSlpqvFIFSLReviqgsgvLDC--------WAdFGFPWGP 196
Cdd:pfam10328  86 LLISLNRFCAVFFPFKYKKIFSIKnTKIIITIIWIISIIIS----TLFYLP--------LGChfyyspetLT-WSFDEPP 152
                         170       180
                  ....*....|....*....|....*.
gi 4502333    197 RAYLTWTTLAIFVLPVTMLTACYSLI 222
Cdd:pfam10328 153 CAEITWYGDFLKNLVLVIITNIINVI 178
DUF1856 super family cl07549
Domain of unknown function (DUF1856); This domain has no known function. It is found in the ...
362-412 1.79e-03

Domain of unknown function (DUF1856); This domain has no known function. It is found in the C-terminal segment of various vasopressin receptors.


The actual alignment was detected with superfamily member pfam08983:

Pssm-ID: 286120  Cd Length: 48  Bit Score: 36.32  E-value: 1.79e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 4502333    362 RMRRRLSDGSlsSRHTTLLTRSSCPAtlsLSLSLTLSGRPRPEESPRDLEL 412
Cdd:pfam08983   1 KLHKEDSDSS--SRRTTLLTNLNRSP---TNSTGSWKDSPKSSKSIKFIPV 46
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
51-338 1.91e-49

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


:

Pssm-ID: 278431 [Multi-domain]  Cd Length: 254  Bit Score: 169.80  E-value: 1.91e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333     51 GNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFqVLPQLLWDITY-RFQGPDLLCRAVKYLQVLSMFASTYMLLAMT 129
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLL-TLPFWLVYALFgTWPFGSALCKLVTALDVVNGYASILLLTAIS 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333    130 LDRYLAVCHPLRSLQQPgQSTYLLIAAPWLLAAIFSLPQvFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFV 209
Cdd:pfam00001  80 IDRYLAIVHPLRYRRIM-RRAKAIILLIWVLALLLSLPP-LLGWNTLDIPSNGVTSCLITFPESLWPVSYLLFSTVVGFL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333    210 LPVTMLTACYSLICHEICKNLKVKTQAwrvggggwrtwdrpspstlaattrglpsrvssintiSRAKIRTVKMTFVIVLA 289
Cdd:pfam00001 158 LPLLVILVCYTRIIRTLRKQARSRRRS------------------------------------VRSERKALKTLLVVVVV 201
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|...
gi 4502333    290 YIACWAPFFSVQMWSVWDKNAP----DEDSTNVAFTISMLLGNLNSCCNPWIY 338
Cdd:pfam00001 202 FILCWLPYHILNLLDSLCDLLIiiscVVTPPRTLLQLTVWLAYSNSCLNPIIY 254
 
Name Accession Description Interval E-value
7TM_GPCR_Srx pfam10328
Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis ...
52-222 1.21e-03

Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srx is part of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


Pssm-ID: 287318  Cd Length: 274  Bit Score: 39.10  E-value: 1.21e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333     52 NLAVLLTLGQLGRKRSRMHLFVLHLALTD---LAVALFQVLPQLLWDITYrfqGPDLLCraVKYLQVLSMFA---STYML 125
Cdd:pfam10328  11 NWLIFYIFLKLPSLKNSFGILCANKAISNaiiCTIFLFYVVPMTLLDLSF---LPELLN--SHIGGLVLLGLyeiSPLTH 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333    126 LAMTLDRYLAVCHPLRSLQQPGQS-TYLLIAAPWLLAAIFSlpqvFIFSLReviqgsgvLDC--------WAdFGFPWGP 196
Cdd:pfam10328  86 LLISLNRFCAVFFPFKYKKIFSIKnTKIIITIIWIISIIIS----TLFYLP--------LGChfyyspetLT-WSFDEPP 152
                         170       180
                  ....*....|....*....|....*.
gi 4502333    197 RAYLTWTTLAIFVLPVTMLTACYSLI 222
Cdd:pfam10328 153 CAEITWYGDFLKNLVLVIITNIINVI 178
DUF1856 pfam08983
Domain of unknown function (DUF1856); This domain has no known function. It is found in the ...
362-412 1.79e-03

Domain of unknown function (DUF1856); This domain has no known function. It is found in the C-terminal segment of various vasopressin receptors.


Pssm-ID: 286120  Cd Length: 48  Bit Score: 36.32  E-value: 1.79e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 4502333    362 RMRRRLSDGSlsSRHTTLLTRSSCPAtlsLSLSLTLSGRPRPEESPRDLEL 412
Cdd:pfam08983   1 KLHKEDSDSS--SRRTTLLTNLNRSP---TNSTGSWKDSPKSSKSIKFIPV 46
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
51-338 1.91e-49

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431 [Multi-domain]  Cd Length: 254  Bit Score: 169.80  E-value: 1.91e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333     51 GNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFqVLPQLLWDITY-RFQGPDLLCRAVKYLQVLSMFASTYMLLAMT 129
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLL-TLPFWLVYALFgTWPFGSALCKLVTALDVVNGYASILLLTAIS 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333    130 LDRYLAVCHPLRSLQQPgQSTYLLIAAPWLLAAIFSLPQvFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFV 209
Cdd:pfam00001  80 IDRYLAIVHPLRYRRIM-RRAKAIILLIWVLALLLSLPP-LLGWNTLDIPSNGVTSCLITFPESLWPVSYLLFSTVVGFL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333    210 LPVTMLTACYSLICHEICKNLKVKTQAwrvggggwrtwdrpspstlaattrglpsrvssintiSRAKIRTVKMTFVIVLA 289
Cdd:pfam00001 158 LPLLVILVCYTRIIRTLRKQARSRRRS------------------------------------VRSERKALKTLLVVVVV 201
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|...
gi 4502333    290 YIACWAPFFSVQMWSVWDKNAP----DEDSTNVAFTISMLLGNLNSCCNPWIY 338
Cdd:pfam00001 202 FILCWLPYHILNLLDSLCDLLIiiscVVTPPRTLLQLTVWLAYSNSCLNPIIY 254
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
38-338 1.97e-13

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 69.81  E-value: 1.97e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333    38 IGVLATVLVLATGGNLAVLlTLGQLGRKRSRMHLFVLHLALTDLAVALfqVLP-QLLWDITYRFQGPDLLCRAVKYLQVL 116
Cdd:PHA03087  44 IVVYSTIFFFGLVGNIIVI-YVLTKTKIKTPMDIYLLNLAVSDLLFVM--TLPfQIYYYILFQWSFGEFACKIVSGLYYI 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333   117 SMFASTYMLLAMTLDRYLAVCHPLRSLQQPG-QSTYLLIAAPWLLAAIFSLPQVFIFSLREViqgSGVLDCWADF---GF 192
Cdd:PHA03087 121 GFYNSMNFITVMSVDRYIAIVHPVKSNKINTvKYGYIVSLVIWIISIIETTPILFVYTTKKD---HETLICCMFYnnkTM 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333   193 PWGPrayltWTTLAI----FVLPVTMLTACYSLICheicknlkvktqawrvggggwrtwdrpspstlaattrglpSRVSS 268
Cdd:PHA03087 198 NWKL-----FINFEIniigMLIPLTILLYCYSKIL----------------------------------------ITLKG 232
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 4502333   269 INtISRAKIRTVKMTFVIVLAYIACWAPF----FSVQMWSVWDKNAPDEDS-TNVAFTISMLLGNLNSCCNPWIY 338
Cdd:PHA03087 233 IN-KSKKNKKAIKLVLIIVILFVIFWLPFnvsvFVYSLHILHFKSGCKAVKyIQYALHVTEIISLSHCCINPLIY 306
 
Name Accession Description Interval E-value
7TM_GPCR_Srx pfam10328
Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis ...
52-222 1.21e-03

Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srx is part of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


Pssm-ID: 287318  Cd Length: 274  Bit Score: 39.10  E-value: 1.21e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333     52 NLAVLLTLGQLGRKRSRMHLFVLHLALTD---LAVALFQVLPQLLWDITYrfqGPDLLCraVKYLQVLSMFA---STYML 125
Cdd:pfam10328  11 NWLIFYIFLKLPSLKNSFGILCANKAISNaiiCTIFLFYVVPMTLLDLSF---LPELLN--SHIGGLVLLGLyeiSPLTH 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333    126 LAMTLDRYLAVCHPLRSLQQPGQS-TYLLIAAPWLLAAIFSlpqvFIFSLReviqgsgvLDC--------WAdFGFPWGP 196
Cdd:pfam10328  86 LLISLNRFCAVFFPFKYKKIFSIKnTKIIITIIWIISIIIS----TLFYLP--------LGChfyyspetLT-WSFDEPP 152
                         170       180
                  ....*....|....*....|....*.
gi 4502333    197 RAYLTWTTLAIFVLPVTMLTACYSLI 222
Cdd:pfam10328 153 CAEITWYGDFLKNLVLVIITNIINVI 178
DUF1856 pfam08983
Domain of unknown function (DUF1856); This domain has no known function. It is found in the ...
362-412 1.79e-03

Domain of unknown function (DUF1856); This domain has no known function. It is found in the C-terminal segment of various vasopressin receptors.


Pssm-ID: 286120  Cd Length: 48  Bit Score: 36.32  E-value: 1.79e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|.
gi 4502333    362 RMRRRLSDGSlsSRHTTLLTRSSCPAtlsLSLSLTLSGRPRPEESPRDLEL 412
Cdd:pfam08983   1 KLHKEDSDSS--SRRTTLLTNLNRSP---TNSTGSWKDSPKSSKSIKFIPV 46
7tm_4 pfam13853
Olfactory receptor; The members of this family are transmembrane olfactory receptors.
41-184 4.21e-03

Olfactory receptor; The members of this family are transmembrane olfactory receptors.


Pssm-ID: 290564  Cd Length: 280  Bit Score: 37.47  E-value: 4.21e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333     41 LATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVA---LFQVLPQLLWDITYRFQGPDLLcrAVKYLQVLS 117
Cdd:pfam13853   1 FCLIYLIIFLGNCTILHVIRTESSLHQPMYLFLAMLALIDLGLSastLPTVLGIFLFGLREISLEACLA--QMFFIHKFS 78
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 4502333    118 MFASTyMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVL 184
Cdd:pfam13853  79 FMESA-VLLAMAFDRFVAICSPLRYSSILTNPVISRIGLGILVRSFILILPLIFLLKRLPFCGHHVL 144
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
51-338 1.91e-49

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431 [Multi-domain]  Cd Length: 254  Bit Score: 169.80  E-value: 1.91e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333     51 GNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFqVLPQLLWDITY-RFQGPDLLCRAVKYLQVLSMFASTYMLLAMT 129
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLL-TLPFWLVYALFgTWPFGSALCKLVTALDVVNGYASILLLTAIS 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333    130 LDRYLAVCHPLRSLQQPgQSTYLLIAAPWLLAAIFSLPQvFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFV 209
Cdd:pfam00001  80 IDRYLAIVHPLRYRRIM-RRAKAIILLIWVLALLLSLPP-LLGWNTLDIPSNGVTSCLITFPESLWPVSYLLFSTVVGFL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333    210 LPVTMLTACYSLICHEICKNLKVKTQAwrvggggwrtwdrpspstlaattrglpsrvssintiSRAKIRTVKMTFVIVLA 289
Cdd:pfam00001 158 LPLLVILVCYTRIIRTLRKQARSRRRS------------------------------------VRSERKALKTLLVVVVV 201
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|...
gi 4502333    290 YIACWAPFFSVQMWSVWDKNAP----DEDSTNVAFTISMLLGNLNSCCNPWIY 338
Cdd:pfam00001 202 FILCWLPYHILNLLDSLCDLLIiiscVVTPPRTLLQLTVWLAYSNSCLNPIIY 254
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
38-338 1.97e-13

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 69.81  E-value: 1.97e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333    38 IGVLATVLVLATGGNLAVLlTLGQLGRKRSRMHLFVLHLALTDLAVALfqVLP-QLLWDITYRFQGPDLLCRAVKYLQVL 116
Cdd:PHA03087  44 IVVYSTIFFFGLVGNIIVI-YVLTKTKIKTPMDIYLLNLAVSDLLFVM--TLPfQIYYYILFQWSFGEFACKIVSGLYYI 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333   117 SMFASTYMLLAMTLDRYLAVCHPLRSLQQPG-QSTYLLIAAPWLLAAIFSLPQVFIFSLREViqgSGVLDCWADF---GF 192
Cdd:PHA03087 121 GFYNSMNFITVMSVDRYIAIVHPVKSNKINTvKYGYIVSLVIWIISIIETTPILFVYTTKKD---HETLICCMFYnnkTM 197
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333   193 PWGPrayltWTTLAI----FVLPVTMLTACYSLICheicknlkvktqawrvggggwrtwdrpspstlaattrglpSRVSS 268
Cdd:PHA03087 198 NWKL-----FINFEIniigMLIPLTILLYCYSKIL----------------------------------------ITLKG 232
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 4502333   269 INtISRAKIRTVKMTFVIVLAYIACWAPF----FSVQMWSVWDKNAPDEDS-TNVAFTISMLLGNLNSCCNPWIY 338
Cdd:PHA03087 233 IN-KSKKNKKAIKLVLIIVILFVIFWLPFnvsvFVYSLHILHFKSGCKAVKyIQYALHVTEIISLSHCCINPLIY 306
PHA02638 PHA02638
CC chemokine receptor-like protein; Provisional
44-178 3.47e-06

CC chemokine receptor-like protein; Provisional


Pssm-ID: 165021 [Multi-domain]  Cd Length: 417  Bit Score: 47.70  E-value: 3.47e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333    44 VLVLATGGNLAVLLTLGQlGRKRSRMHLFVLHLALTDLavaLFQV-LPQLLWDITYRFQGPDLLCRAVKYLQVLSMFAST 122
Cdd:PHA02638 108 IFILGLFGNAAIIMILFC-KKIKTITDIYIFNLAISDL---IFVIdFPFIIYNEFDQWIFGDFMCKVISASYYIGFFSNM 183
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333   123 YMLLAMTLDRYLAVCHPLrSLQQpgQSTY----LLIAAPWLLAAIFSLPQVFIFSLREVI 178
Cdd:PHA02638 184 FLITLMSIDRYFAILYPI-SFQK--YRTFnigiILCIISWILSLIITSPAYFIFEASNII 240
PHA02834 PHA02834
chemokine receptor-like protein; Provisional
104-239 9.02e-03

chemokine receptor-like protein; Provisional


Pssm-ID: 165177 [Multi-domain]  Cd Length: 323  Bit Score: 36.42  E-value: 9.02e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333   104 DLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGV 183
Cdd:PHA02834  95 EFMCKLVLGVYFVGFFSNMFFVTLISIDRYILVVNATKIKNKSISLSVLLSVAAWVCSVILSMPAMVLYYVDNTDNLKQC 174
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 4502333   184 LDCWADFGFPWgpRAYLTWtTLAIF--VLPVTMLTACYSLICHEI--CKNlKVKTQAWRV 239
Cdd:PHA02834 175 IFNDYHENFSW--SAFFNF-EINIFgiVIPLIILIYCYSKILYTLknCKN-KNKTRSIKI 230
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH