NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|41393133|ref|NP_958896|]
View 

protein phosphatase 1G [Danio rerio]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
323-488 4.95e-57

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 191.77  E-value: 4.95e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133 323 GSDSGTTAVVALIRGKQLIVANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGKVtMDGRVNGGLNLSRAIGDH 402
Cdd:cd00143  96 DARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGGRV-SNGRVPGVLAVTRALGDF 174
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133 403 FYKrnkalpaeeQMISALPDVKVLTLNDDHEFMVIACDGIWNVMSSQEVIDFVSERMKTESgknnpLSAIIDELLDHCLA 482
Cdd:cd00143 175 DLK---------PGVSAEPDVTVVKLTEDDDFLILASDGLWDVLSNQEAVDIVRSELAKED-----LQEAAQELVDLALR 240

                ....*.
gi 41393133 483 PDTSGD 488
Cdd:cd00143 241 RGSHDN 246
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
24-116 6.14e-20

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 88.54  E-value: 6.14e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133  24 YGFSAMQGWRVSMEDAHNCIPELDDE-TAMFAVYDGHGGEEVALYCSKYLPGIIKEQK----TYKEGKLQKALEDAFLDI 98
Cdd:cd00143   3 AGVSDKGGDRKTNEDAVVIKPNLNNEdGGLFGVFDGHGGHAAGEFASKLLVEELLEELeetlTLSEEDIEEALRKAFLRA 82
                        90
                ....*....|....*...
gi 41393133  99 DARITTEEVIKELVQIAG 116
Cdd:cd00143  83 DEEILEEAQDEPDDARSG 100
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
323-488 4.95e-57

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 191.77  E-value: 4.95e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133 323 GSDSGTTAVVALIRGKQLIVANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGKVtMDGRVNGGLNLSRAIGDH 402
Cdd:cd00143  96 DARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGGRV-SNGRVPGVLAVTRALGDF 174
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133 403 FYKrnkalpaeeQMISALPDVKVLTLNDDHEFMVIACDGIWNVMSSQEVIDFVSERMKTESgknnpLSAIIDELLDHCLA 482
Cdd:cd00143 175 DLK---------PGVSAEPDVTVVKLTEDDDFLILASDGLWDVLSNQEAVDIVRSELAKED-----LQEAAQELVDLALR 240

                ....*.
gi 41393133 483 PDTSGD 488
Cdd:cd00143 241 RGSHDN 246
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
24-116 6.14e-20

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 88.54  E-value: 6.14e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133  24 YGFSAMQGWRVSMEDAHNCIPELDDE-TAMFAVYDGHGGEEVALYCSKYLPGIIKEQK----TYKEGKLQKALEDAFLDI 98
Cdd:cd00143   3 AGVSDKGGDRKTNEDAVVIKPNLNNEdGGLFGVFDGHGGHAAGEFASKLLVEELLEELeetlTLSEEDIEEALRKAFLRA 82
                        90
                ....*....|....*...
gi 41393133  99 DARITTEEVIKELVQIAG 116
Cdd:cd00143  83 DEEILEEAQDEPDDARSG 100
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
324-486 4.73e-58

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 194.50  E-value: 4.73e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133   324 SDSGTTAVVALIRGKQLIVANAGDSRCVVSEKGKALD-MSYDHKPEDELELARIKNAGGKVTMDGRVNGGLNLSRAIGDH 402
Cdd:pfam00481  97 LSSGSTAVVALIRGNKLYVANVGDSRAVLCRNGGAIKqLTEDHKPSDEDERRRIRAAGGFVSRNGRVNGVLAVSRAFGDF 176
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133   403 FYKRNkalpaeEQMISALPDVKVLTLNDDHEFMVIACDGIWNVMSSQEVIDFVSERMKtesgKNNPLSAIIDELLDHCLA 482
Cdd:pfam00481 177 DLKPG------EQPVSAEPDITSHKITEDDEFLILACDGLWDVLSDQEVVDIVRSNLS----DGGDPMEAAEKLVDEAIA 246

                  ....
gi 41393133   483 PDTS 486
Cdd:pfam00481 247 YGSE 250
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
320-483 2.23e-54

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 184.50  E-value: 2.23e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133    320 EEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGKVtMDGRVNGGLNLSRAI 399
Cdd:smart00332  94 EELEALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNEDERARIEAAGGFV-INGRVNGVLALSRAI 172
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133    400 GDHFYKrnkalpaeeQMISALPDVKVLTLNDDHEFMVIACDGIWNVMSSQEVIDFVSERmktesgKNNPLSAIIDELLDH 479
Cdd:smart00332 173 GDFFLK---------PYVSAEPDVTVVELTEKDDFLILASDGLWDVLSNQEVVDIVRKH------LSKDPKEAAKRLIDL 237

                   ....
gi 41393133    480 CLAP 483
Cdd:smart00332 238 ALAR 241
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
324-458 1.86e-27

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 110.14  E-value: 1.86e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133 324 SDSGTTAVVALIRGKQLIVANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGKVTMDGRvnggLNLSRAIGDHF 403
Cdd:COG0631 106 RGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEARSHPRR----NALTRALGDFD 181
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*
gi 41393133 404 YkrnkalpaeeqmisALPDVKVLTLNDDhEFMVIACDGIWNVMSSQEVIDFVSER 458
Cdd:COG0631 182 L--------------LEPDITELELEPG-DFLLLCSDGLWDVVSDDEIVDILKNS 221
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
24-109 2.39e-23

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 98.22  E-value: 2.39e-23
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133     24 YGFSAMQGWRVSMEDAHNCIPELDDETAMFAVYDGHGGEEVALYCSKYLPGIIKEQKTYKEGKLQK---ALEDAFLDIDA 100
Cdd:smart00332  11 YGLSSMQGVRKPMEDAHVITPDLSDSGGFFGVFDGHGGSEAAKFLSKNLPEILAEELIKEKDELEDveeALRKAFLSTDE 90

                   ....*....
gi 41393133    101 RITTEEVIK 109
Cdd:smart00332  91 EILEELEAL 99
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
24-110 4.26e-17

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 80.10  E-value: 4.26e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133    24 YGFSAMQGWRVSMEDAHNCIP-----ELDDETAMFAVYDGHGGEEVALYCSKYLPGIIKEQKTYKEG-KLQKALEDAFLD 97
Cdd:pfam00481   3 VGGTRMQGWRKSMEDAHIDGKnlnssSGKDSWSFFAVFDGHGGSEAAKYAGKHLHTILALRRSFLTLrKLEDALRESFLE 82
                          90
                  ....*....|...
gi 41393133    98 IDARITTEEVIKE 110
Cdd:pfam00481  83 TDEELRSDAANHE 95
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
24-116 9.99e-12

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 63.91  E-value: 9.99e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133  24 YGFSAMQGWRVSMEDAHNCIPELD-DETAMFAVYDGHGGEEVALYCSKYLPGIIKEQ-----KTYKEGKLQKALEDAFLD 97
Cdd:COG0631  11 AGLSDVGTVRKHNEDAFLIKPNENgNLLLLFAVADGMGGHAAGEVASKLAVEALARLfdetnFNSLNESLEELLKEAILK 90
                        90
                ....*....|....*....
gi 41393133  98 IDARITTEEVIKELVQIAG 116
Cdd:COG0631  91 ANEAIAEEGQLNEDVRGMG 109
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
326-489 4.16e-32

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 125.41  E-value: 4.16e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133  326 SGTTAVVALIRGKQLIVANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGKVtMDGRVNGGLNLSRAIGDHFYK 405
Cdd:PLN03145 166 SGTTALAALVVGRSLVVANAGDCRAVLCRRGKAIEMSRDHKPMCSKERKRIEASGGYV-YDGYLNGQLNVARALGDWHME 244
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133  406 RNKAlpAEEQMISALPDVKVLTLNDDHEFMVIACDGIWNVMSSQEVIDFVSERMKTEsgkNNPLsAIIDELLDHCLApDT 485
Cdd:PLN03145 245 GMKG--SDGGPLSAEPELMTTQLTEEDEFLIIGCDGIWDVFRSQNAVDFARRRLQEH---NDPV-MCSKELVDEALK-RK 317

                 ....
gi 41393133  486 SGDS 489
Cdd:PLN03145 318 SGDN 321
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
323-461 9.71e-27

protein phosphatase 2C; Provisional


Pssm-ID: 240318 [Multi-domain]  Cd Length: 381  Bit Score: 109.86  E-value: 9.71e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133  323 GSDSGTTAVVALIRGK-QLIVANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGKVtMDGRVNGGLNLSRAIGD 401
Cdd:PTZ00224 101 GREGGSTGTFCVIMKDvHLQVGNVGDSRVLVCRDGKLVFATEDHKPNNPGERQRIEACGGRV-VSNRVDGDLAVSRAFGD 179
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 41393133  402 HFYKRNKALPAEEQMISALPDVKVLTLNDDhEFMVIACDGIWN-VMSSQEVIDFVSERMKT 461
Cdd:PTZ00224 180 RSFKVKGTGDYLEQKVIAVPDVTHLTCQSN-DFIILACDGVFEgNFSNEEVVAFVKEQLET 239
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
323-488 4.95e-57

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 191.77  E-value: 4.95e-57
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133 323 GSDSGTTAVVALIRGKQLIVANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGKVtMDGRVNGGLNLSRAIGDH 402
Cdd:cd00143  96 DARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGGRV-SNGRVPGVLAVTRALGDF 174
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133 403 FYKrnkalpaeeQMISALPDVKVLTLNDDHEFMVIACDGIWNVMSSQEVIDFVSERMKTESgknnpLSAIIDELLDHCLA 482
Cdd:cd00143 175 DLK---------PGVSAEPDVTVVKLTEDDDFLILASDGLWDVLSNQEAVDIVRSELAKED-----LQEAAQELVDLALR 240

                ....*.
gi 41393133 483 PDTSGD 488
Cdd:cd00143 241 RGSHDN 246
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
24-116 6.14e-20

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 88.54  E-value: 6.14e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133  24 YGFSAMQGWRVSMEDAHNCIPELDDE-TAMFAVYDGHGGEEVALYCSKYLPGIIKEQK----TYKEGKLQKALEDAFLDI 98
Cdd:cd00143   3 AGVSDKGGDRKTNEDAVVIKPNLNNEdGGLFGVFDGHGGHAAGEFASKLLVEELLEELeetlTLSEEDIEEALRKAFLRA 82
                        90
                ....*....|....*...
gi 41393133  99 DARITTEEVIKELVQIAG 116
Cdd:cd00143  83 DEEILEEAQDEPDDARSG 100
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
324-486 4.73e-58

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 194.50  E-value: 4.73e-58
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133   324 SDSGTTAVVALIRGKQLIVANAGDSRCVVSEKGKALD-MSYDHKPEDELELARIKNAGGKVTMDGRVNGGLNLSRAIGDH 402
Cdd:pfam00481  97 LSSGSTAVVALIRGNKLYVANVGDSRAVLCRNGGAIKqLTEDHKPSDEDERRRIRAAGGFVSRNGRVNGVLAVSRAFGDF 176
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133   403 FYKRNkalpaeEQMISALPDVKVLTLNDDHEFMVIACDGIWNVMSSQEVIDFVSERMKtesgKNNPLSAIIDELLDHCLA 482
Cdd:pfam00481 177 DLKPG------EQPVSAEPDITSHKITEDDEFLILACDGLWDVLSDQEVVDIVRSNLS----DGGDPMEAAEKLVDEAIA 246

                  ....
gi 41393133   483 PDTS 486
Cdd:pfam00481 247 YGSE 250
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
320-483 2.23e-54

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 184.50  E-value: 2.23e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133    320 EEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGKVtMDGRVNGGLNLSRAI 399
Cdd:smart00332  94 EELEALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNEDERARIEAAGGFV-INGRVNGVLALSRAI 172
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133    400 GDHFYKrnkalpaeeQMISALPDVKVLTLNDDHEFMVIACDGIWNVMSSQEVIDFVSERmktesgKNNPLSAIIDELLDH 479
Cdd:smart00332 173 GDFFLK---------PYVSAEPDVTVVELTEKDDFLILASDGLWDVLSNQEVVDIVRKH------LSKDPKEAAKRLIDL 237

                   ....
gi 41393133    480 CLAP 483
Cdd:smart00332 238 ALAR 241
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
324-458 1.86e-27

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 110.14  E-value: 1.86e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133 324 SDSGTTAVVALIRGKQLIVANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGKVTMDGRvnggLNLSRAIGDHF 403
Cdd:COG0631 106 RGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEARSHPRR----NALTRALGDFD 181
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*
gi 41393133 404 YkrnkalpaeeqmisALPDVKVLTLNDDhEFMVIACDGIWNVMSSQEVIDFVSER 458
Cdd:COG0631 182 L--------------LEPDITELELEPG-DFLLLCSDGLWDVVSDDEIVDILKNS 221
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
24-109 2.39e-23

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 98.22  E-value: 2.39e-23
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133     24 YGFSAMQGWRVSMEDAHNCIPELDDETAMFAVYDGHGGEEVALYCSKYLPGIIKEQKTYKEGKLQK---ALEDAFLDIDA 100
Cdd:smart00332  11 YGLSSMQGVRKPMEDAHVITPDLSDSGGFFGVFDGHGGSEAAKFLSKNLPEILAEELIKEKDELEDveeALRKAFLSTDE 90

                   ....*....
gi 41393133    101 RITTEEVIK 109
Cdd:smart00332  91 EILEELEAL 99
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
24-110 4.26e-17

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 80.10  E-value: 4.26e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133    24 YGFSAMQGWRVSMEDAHNCIP-----ELDDETAMFAVYDGHGGEEVALYCSKYLPGIIKEQKTYKEG-KLQKALEDAFLD 97
Cdd:pfam00481   3 VGGTRMQGWRKSMEDAHIDGKnlnssSGKDSWSFFAVFDGHGGSEAAKYAGKHLHTILALRRSFLTLrKLEDALRESFLE 82
                          90
                  ....*....|...
gi 41393133    98 IDARITTEEVIKE 110
Cdd:pfam00481  83 TDEELRSDAANHE 95
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
24-116 9.99e-12

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 63.91  E-value: 9.99e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133  24 YGFSAMQGWRVSMEDAHNCIPELD-DETAMFAVYDGHGGEEVALYCSKYLPGIIKEQ-----KTYKEGKLQKALEDAFLD 97
Cdd:COG0631  11 AGLSDVGTVRKHNEDAFLIKPNENgNLLLLFAVADGMGGHAAGEVASKLAVEALARLfdetnFNSLNESLEELLKEAILK 90
                        90
                ....*....|....*....
gi 41393133  98 IDARITTEEVIKELVQIAG 116
Cdd:COG0631  91 ANEAIAEEGQLNEDVRGMG 109
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
326-489 4.16e-32

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 125.41  E-value: 4.16e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133  326 SGTTAVVALIRGKQLIVANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGKVtMDGRVNGGLNLSRAIGDHFYK 405
Cdd:PLN03145 166 SGTTALAALVVGRSLVVANAGDCRAVLCRRGKAIEMSRDHKPMCSKERKRIEASGGYV-YDGYLNGQLNVARALGDWHME 244
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133  406 RNKAlpAEEQMISALPDVKVLTLNDDHEFMVIACDGIWNVMSSQEVIDFVSERMKTEsgkNNPLsAIIDELLDHCLApDT 485
Cdd:PLN03145 245 GMKG--SDGGPLSAEPELMTTQLTEEDEFLIIGCDGIWDVFRSQNAVDFARRRLQEH---NDPV-MCSKELVDEALK-RK 317

                 ....
gi 41393133  486 SGDS 489
Cdd:PLN03145 318 SGDN 321
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
323-461 9.71e-27

protein phosphatase 2C; Provisional


Pssm-ID: 240318 [Multi-domain]  Cd Length: 381  Bit Score: 109.86  E-value: 9.71e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133  323 GSDSGTTAVVALIRGK-QLIVANAGDSRCVVSEKGKALDMSYDHKPEDELELARIKNAGGKVtMDGRVNGGLNLSRAIGD 401
Cdd:PTZ00224 101 GREGGSTGTFCVIMKDvHLQVGNVGDSRVLVCRDGKLVFATEDHKPNNPGERQRIEACGGRV-VSNRVDGDLAVSRAFGD 179
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 41393133  402 HFYKRNKALPAEEQMISALPDVKVLTLNDDhEFMVIACDGIWN-VMSSQEVIDFVSERMKT 461
Cdd:PTZ00224 180 RSFKVKGTGDYLEQKVIAVPDVTHLTCQSN-DFIILACDGVFEgNFSNEEVVAFVKEQLET 239
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
1-97 4.94e-10

protein phosphatase 2C; Provisional


Pssm-ID: 240318 [Multi-domain]  Cd Length: 381  Bit Score: 59.79  E-value: 4.94e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133    1 MGAYLSQPNMEKSTGNGGSKNLNYGFSAMQGWRVSMEDAHncIPELDDETAMFAVYDGHGGEEVALYCSKYLPGII-KEQ 79
Cdd:PTZ00224   1 MGIMLPKPVLSKLVDRAGNSIFRCASACVNGYRESMEDAH--LLYLTDDWGFFGVFDGHVNDECSQYLARAWPQALeKEP 78
                         90       100
                 ....*....|....*....|.
gi 41393133   80 KTYKEGKLQK---ALEDAFLD 97
Cdd:PTZ00224  79 EPMTDERMEElclEIDEEWMD 99
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
31-100 3.78e-06

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 47.60  E-value: 3.78e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41393133   31 GWRVSMEDAHNCIPELDDE----------TAMFAVYDGHGGEEVALYCSKYLPGIIKEQKTYKEgKLQKALEDAFLDIDA 100
Cdd:PLN03145  74 GSRSSMEDVYICVDNFMSDfglknsedgpSAFYGVFDGHGGKHAADFACYHLPRFIVEDEDFPR-EIEKVVSSAFLQTDT 152
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH