NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|41054373|ref|NP_956007|]
View 

calreticulin precursor [Danio rerio]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Calreticulin pfam00262
Calreticulin family;
22-333 5.49e-166

Calreticulin family;


:

Pssm-ID: 249724  Cd Length: 359  Bit Score: 473.71  E-value: 5.49e-166
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373    22 VYFREQFEDGDSWRSRWVESKHKTDY-GKFVLSAGKFYGDAEKDKGLQTSQDAHFYAMSARF-GDFNNKDQPLVIQFSVK 99
Cdd:pfam00262   1 VYFFEQFDDDDLWEKRWIPSKAKKDDdGKWKVEAGKFYGGEEKDKGLVTKDDAKFYAISAKFpKPFSNKGKTLVVQYEVK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373   100 HEQNIDCGGGYIKLFPSDLNQEDMHGDSTYNIMFGPDICGPGTKKVHVIFN------YKGKNHLINKDIRCKDdEYSHLY 173
Cdd:pfam00262  81 LQQGIDCGGAYIKLLSKDFDQKDFSGETPYTIMFGPDICGSDTKKVHFIFRhkpitgYKEEKHLIKKPISRCD-KLTHLY 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373   174 TLIVNPDNTYEVKIDNKKVESGSLEEDWD--FLPSKKIKDPEAKKPEDWDEREKIDDPEDQKPEEWD------------- 238
Cdd:pfam00262 160 TLIIRPDNTFEILIDGEVVKSGSLLEDFDppFNPPKEIPDPTDKKPEDWDDREKIPDPEAKKPEDWDedepefipdpnav 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373   239 --------KPENIPDPDAKKPDDWDEEMDGEWEPPMVTNP-----------------DYKGEWKPRQIDNPAYKGKWVHP 293
Cdd:pfam00262 240 kpegwledEPEYIPDPDATKPEDWDDEEDGEWEAPMIPNPkcekacgcgkppmiknpKYKGKWKPPMIDNPNYKGVWKPR 319
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|
gi 41054373   294 EIDNPEYTPDSEIYKYDSIGVIGLDLWQVKSSTIFDNFLI 333
Cdd:pfam00262 320 KIPNPDYFEDPNPYNLEPIGAIGFELWQVKSGILFDNILI 359
 
Name Accession Description Interval E-value
Calreticulin pfam00262
Calreticulin family;
22-333 5.49e-166

Calreticulin family;


Pssm-ID: 249724  Cd Length: 359  Bit Score: 473.71  E-value: 5.49e-166
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373    22 VYFREQFEDGDSWRSRWVESKHKTDY-GKFVLSAGKFYGDAEKDKGLQTSQDAHFYAMSARF-GDFNNKDQPLVIQFSVK 99
Cdd:pfam00262   1 VYFFEQFDDDDLWEKRWIPSKAKKDDdGKWKVEAGKFYGGEEKDKGLVTKDDAKFYAISAKFpKPFSNKGKTLVVQYEVK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373   100 HEQNIDCGGGYIKLFPSDLNQEDMHGDSTYNIMFGPDICGPGTKKVHVIFN------YKGKNHLINKDIRCKDdEYSHLY 173
Cdd:pfam00262  81 LQQGIDCGGAYIKLLSKDFDQKDFSGETPYTIMFGPDICGSDTKKVHFIFRhkpitgYKEEKHLIKKPISRCD-KLTHLY 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373   174 TLIVNPDNTYEVKIDNKKVESGSLEEDWD--FLPSKKIKDPEAKKPEDWDEREKIDDPEDQKPEEWD------------- 238
Cdd:pfam00262 160 TLIIRPDNTFEILIDGEVVKSGSLLEDFDppFNPPKEIPDPTDKKPEDWDDREKIPDPEAKKPEDWDedepefipdpnav 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373   239 --------KPENIPDPDAKKPDDWDEEMDGEWEPPMVTNP-----------------DYKGEWKPRQIDNPAYKGKWVHP 293
Cdd:pfam00262 240 kpegwledEPEYIPDPDATKPEDWDDEEDGEWEAPMIPNPkcekacgcgkppmiknpKYKGKWKPPMIDNPNYKGVWKPR 319
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|
gi 41054373   294 EIDNPEYTPDSEIYKYDSIGVIGLDLWQVKSSTIFDNFLI 333
Cdd:pfam00262 320 KIPNPDYFEDPNPYNLEPIGAIGFELWQVKSGILFDNILI 359
Granin pfam01271
Granin (chromogranin or secretogranin);
208-288 3.55e-04

Granin (chromogranin or secretogranin);


Pssm-ID: 250493 [Multi-domain]  Cd Length: 585  Bit Score: 41.52  E-value: 3.55e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373   208 KIKDPEAKKPEDWDEREKIDDPEDqkpEEWDKPENIPDPDAKKPDDWDEEMDG-EWEPPMVTNPDYKGEWKPRQIDNPAY 286
Cdd:pfam01271 182 KLDGQSKQKRERSDEREKSYQDDE---DDTYRQNNIPYEDVVGGEDWNPIEEGeEDQTQEEVKRSKERTHKGRSLPDESK 258

                  ..
gi 41054373   287 KG 288
Cdd:pfam01271 259 RS 260
 
Name Accession Description Interval E-value
Calreticulin pfam00262
Calreticulin family;
22-333 5.49e-166

Calreticulin family;


Pssm-ID: 249724  Cd Length: 359  Bit Score: 473.71  E-value: 5.49e-166
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373    22 VYFREQFEDGDSWRSRWVESKHKTDY-GKFVLSAGKFYGDAEKDKGLQTSQDAHFYAMSARF-GDFNNKDQPLVIQFSVK 99
Cdd:pfam00262   1 VYFFEQFDDDDLWEKRWIPSKAKKDDdGKWKVEAGKFYGGEEKDKGLVTKDDAKFYAISAKFpKPFSNKGKTLVVQYEVK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373   100 HEQNIDCGGGYIKLFPSDLNQEDMHGDSTYNIMFGPDICGPGTKKVHVIFN------YKGKNHLINKDIRCKDdEYSHLY 173
Cdd:pfam00262  81 LQQGIDCGGAYIKLLSKDFDQKDFSGETPYTIMFGPDICGSDTKKVHFIFRhkpitgYKEEKHLIKKPISRCD-KLTHLY 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373   174 TLIVNPDNTYEVKIDNKKVESGSLEEDWD--FLPSKKIKDPEAKKPEDWDEREKIDDPEDQKPEEWD------------- 238
Cdd:pfam00262 160 TLIIRPDNTFEILIDGEVVKSGSLLEDFDppFNPPKEIPDPTDKKPEDWDDREKIPDPEAKKPEDWDedepefipdpnav 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373   239 --------KPENIPDPDAKKPDDWDEEMDGEWEPPMVTNP-----------------DYKGEWKPRQIDNPAYKGKWVHP 293
Cdd:pfam00262 240 kpegwledEPEYIPDPDATKPEDWDDEEDGEWEAPMIPNPkcekacgcgkppmiknpKYKGKWKPPMIDNPNYKGVWKPR 319
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|
gi 41054373   294 EIDNPEYTPDSEIYKYDSIGVIGLDLWQVKSSTIFDNFLI 333
Cdd:pfam00262 320 KIPNPDYFEDPNPYNLEPIGAIGFELWQVKSGILFDNILI 359
Granin pfam01271
Granin (chromogranin or secretogranin);
208-288 3.55e-04

Granin (chromogranin or secretogranin);


Pssm-ID: 250493 [Multi-domain]  Cd Length: 585  Bit Score: 41.52  E-value: 3.55e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 41054373   208 KIKDPEAKKPEDWDEREKIDDPEDqkpEEWDKPENIPDPDAKKPDDWDEEMDG-EWEPPMVTNPDYKGEWKPRQIDNPAY 286
Cdd:pfam01271 182 KLDGQSKQKRERSDEREKSYQDDE---DDTYRQNNIPYEDVVGGEDWNPIEEGeEDQTQEEVKRSKERTHKGRSLPDESK 258

                  ..
gi 41054373   287 KG 288
Cdd:pfam01271 259 RS 260
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH