NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|402907971|ref|XP_003916733.1|]
View 

PREDICTED: voltage-dependent calcium channel gamma-3 subunit [Papio anubis]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Claudin_2 super family cl21598
PMP-22/EMP/MP20/Claudin tight junction; Members of this family are claudins, that form tight ...
6-196 1.46e-40

PMP-22/EMP/MP20/Claudin tight junction; Members of this family are claudins, that form tight junctions between cells.


The actual alignment was detected with superfamily member pfam00822:

Pssm-ID: 277554  Cd Length: 161  Bit Score: 140.58  E-value: 1.46e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402907971    6 RGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCrtkstsdnetsrkneeVMTHSGLWRTCCLEGA-FRGVCKKidhfP 84
Cdd:pfam00822   1 MLVLLLGFIVSHIAWVILLFVATIPDQWKVSRYVG----------------AAASAGLWRNCTTQSCtGQISCKV----L 60
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402907971   85 EDADYEQDTAEYLLRAVrassVFPILSVTLLFFGGLCVAASEFHRSrhnvilsAGIFFVSAGLSNIIGIIVYISANAGDP 164
Cdd:pfam00822  61 ELNDALQAVQALMILSI----ILGIISLIVFFFQLFTMRKGGRFKL-------AGIIFLVSGLCVLVGASIYTSRIATDF 129
                         170       180       190
                  ....*....|....*....|....*....|..
gi 402907971  165 GQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVA 196
Cdd:pfam00822 130 GNPFTNRKYSFGYSFILGWVAFALAFIGGVLY 161
 
Name Accession Description Interval E-value
PMP22_Claudin pfam00822
PMP-22/EMP/MP20/Claudin family;
6-196 1.46e-40

PMP-22/EMP/MP20/Claudin family;


Pssm-ID: 250157  Cd Length: 161  Bit Score: 140.58  E-value: 1.46e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402907971    6 RGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCrtkstsdnetsrkneeVMTHSGLWRTCCLEGA-FRGVCKKidhfP 84
Cdd:pfam00822   1 MLVLLLGFIVSHIAWVILLFVATIPDQWKVSRYVG----------------AAASAGLWRNCTTQSCtGQISCKV----L 60
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402907971   85 EDADYEQDTAEYLLRAVrassVFPILSVTLLFFGGLCVAASEFHRSrhnvilsAGIFFVSAGLSNIIGIIVYISANAGDP 164
Cdd:pfam00822  61 ELNDALQAVQALMILSI----ILGIISLIVFFFQLFTMRKGGRFKL-------AGIIFLVSGLCVLVGASIYTSRIATDF 129
                         170       180       190
                  ....*....|....*....|....*....|..
gi 402907971  165 GQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVA 196
Cdd:pfam00822 130 GNPFTNRKYSFGYSFILGWVAFALAFIGGVLY 161
 
Name Accession Description Interval E-value
PMP22_Claudin pfam00822
PMP-22/EMP/MP20/Claudin family;
6-196 1.46e-40

PMP-22/EMP/MP20/Claudin family;


Pssm-ID: 250157  Cd Length: 161  Bit Score: 140.58  E-value: 1.46e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402907971    6 RGIQMLITTVGAFAAFSLMTIAVGTDYWLYSRGVCrtkstsdnetsrkneeVMTHSGLWRTCCLEGA-FRGVCKKidhfP 84
Cdd:pfam00822   1 MLVLLLGFIVSHIAWVILLFVATIPDQWKVSRYVG----------------AAASAGLWRNCTTQSCtGQISCKV----L 60
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402907971   85 EDADYEQDTAEYLLRAVrassVFPILSVTLLFFGGLCVAASEFHRSrhnvilsAGIFFVSAGLSNIIGIIVYISANAGDP 164
Cdd:pfam00822  61 ELNDALQAVQALMILSI----ILGIISLIVFFFQLFTMRKGGRFKL-------AGIIFLVSGLCVLVGASIYTSRIATDF 129
                         170       180       190
                  ....*....|....*....|....*....|..
gi 402907971  165 GQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVA 196
Cdd:pfam00822 130 GNPFTNRKYSFGYSFILGWVAFALAFIGGVLY 161
Claudin_2 pfam13903
PMP-22/EMP/MP20/Claudin tight junction; Members of this family are claudins, that form tight ...
18-188 4.45e-17

PMP-22/EMP/MP20/Claudin tight junction; Members of this family are claudins, that form tight junctions between cells.


Pssm-ID: 258170  Cd Length: 169  Bit Score: 76.25  E-value: 4.45e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402907971   18 FAAFSLMTIAVGTDYWLYSRgVCRTKSTSDNetsRKNEEVMTHSGLWRTCclegafrgvckkidhFPEDADYEQDTAEYL 97
Cdd:pfam13903   1 CLALVLLLVALATDYWVEAD-PRRTNSTENG---SVNTGLFDHLGLWRIC---------------FRSEVDVNNFRDTAL 61
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402907971   98 LRAVRASSVFPILSVTLLFFGGLCVAASEFHRSRHnVILSAGIFFVSAGLSNIIGIIVY-------ISANAGDPGQRDSK 170
Cdd:pfam13903  62 PDLTRVVIAFLALGLVLSLLAAVLGLLSAVKKSVR-LLLLTGVLLLLAGVLGLIAVVLYvqkvqlnIKRVVQTWPSEHSS 140
                         170
                  ....*....|....*....
gi 402907971  171 KSY-SYGWSFYFGAFSFII 188
Cdd:pfam13903 141 NGLaRLGWSFYLAVVGTVL 159
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH