NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|402898617|ref|XP_003912317|]
View 

PREDICTED: telomerase Cajal body protein 1 isoform 1 [Papio anubis]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
175-480 8.77e-33

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


:

Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 126.30  E-value: 8.77e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 175 CKWAPDGSCILTNSADNILRIYNLPPELYHDGEQVEYAEMVPVlrmvegdtiydycwyslmsSAQPDTSYVASSSRENPI 254
Cdd:cd00200   15 VAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDV-------------------AASADGTYLASGSSDKTI 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 255 HIWDAFTGELRASFRAynHLDELTaahSLCFSPDGSQLF-CGFNRTVRVFSTarpgRDCEVRATFakkQGQSGIISCIAF 333
Cdd:cd00200   76 RLWDLETGECVRTLTG--HTSYVS---SVAFSPDGRILSsSSRDKTIKVWDV----ETGKCLTTL---RGHTDWVNSVAF 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 334 SPAQPLYACGSYGRSLGLYAWGDGSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWDLRQpgyplwslGREVTT 413
Cdd:cd00200  144 SPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSS-DGTIKLWDLST--------GKCLGT 214
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 402898617 414 ----NQRIYF-DLDPTGQFLVSGSTSGAVSVWDTggpgNDGKPESMLSfLPQNDCTnGVSLHPSLPLLATAS 480
Cdd:cd00200  215 lrghENGVNSvAFSPDGYLLASGSEDGTIRVWDL----RTGECVQTLS-GHTNSVT-SLAWSPDGKRLASGS 280
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
137-482 6.35e-23

FOG: WD40 repeat [General function prediction only]


:

Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 100.55  E-value: 6.35e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 137 AAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELyhdgeqveyaEMVP 216
Cdd:COG2319   33 LGSSESGILLLALLSDSLVSLPDLSSLLLRGHEDSITSIAFSPDGELLLSGSSDGTIKLWDLDNGE----------KLIK 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 217 VLRMVEGDTIYDYCWYSlmssaqPDTSYVAS--SSRENPIHIWDaFTGELRASFRAYNHLDELTaahSLCFSPDGSQLFC 294
Cdd:COG2319  103 SLEGLHDSSVSKLALSS------PDGNSILLasSSLDGTVKLWD-LSTPGKLIRTLEGHSESVT---SLAFSPDGKLLAS 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 295 G--FNRTVRVFSTARPgrdcEVRATFAkkqGQSGIISCIAFSPAQPLY-ACGSYGRSLGLYAWGDGSPLA-LLGGHQGGI 370
Cdd:COG2319  173 GssLDGTIKLWDLRTG----KPLSTLA---GHTDPVSSLAFSPDGGLLiASGSSDGTIRLWDLSTGKLLRsTLSGHSDSV 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 371 THlCFHPDGNRFFSGARkDAELLCWDLRQPGYPLWSLGREvttNQRIY-FDLDPTGQFLVSGSTSGAVSVWDTggpgNDG 449
Cdd:COG2319  246 VS-SFSPDGSLLASGSS-DGTIRLWDLRSSSSLLRTLSGH---SSSVLsVAFSPDGKLLASGSSDGTVRLWDL----ETG 316
                        330       340       350
                 ....*....|....*....|....*....|...
gi 402898617 450 KPESMLSFLPQNDCTNGVSLHPSLPLLATASGQ 482
Cdd:COG2319  317 KLLSSLTLKGHEGPVSSLSFSPDGSLLVSGGSD 349
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
175-480 8.77e-33

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 126.30  E-value: 8.77e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 175 CKWAPDGSCILTNSADNILRIYNLPPELYHDGEQVEYAEMVPVlrmvegdtiydycwyslmsSAQPDTSYVASSSRENPI 254
Cdd:cd00200   15 VAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDV-------------------AASADGTYLASGSSDKTI 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 255 HIWDAFTGELRASFRAynHLDELTaahSLCFSPDGSQLF-CGFNRTVRVFSTarpgRDCEVRATFakkQGQSGIISCIAF 333
Cdd:cd00200   76 RLWDLETGECVRTLTG--HTSYVS---SVAFSPDGRILSsSSRDKTIKVWDV----ETGKCLTTL---RGHTDWVNSVAF 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 334 SPAQPLYACGSYGRSLGLYAWGDGSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWDLRQpgyplwslGREVTT 413
Cdd:cd00200  144 SPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSS-DGTIKLWDLST--------GKCLGT 214
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 402898617 414 ----NQRIYF-DLDPTGQFLVSGSTSGAVSVWDTggpgNDGKPESMLSfLPQNDCTnGVSLHPSLPLLATAS 480
Cdd:cd00200  215 lrghENGVNSvAFSPDGYLLASGSEDGTIRVWDL----RTGECVQTLS-GHTNSVT-SLAWSPDGKRLASGS 280
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
356-396 3.18e-06

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 44.61  E-value: 3.18e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
gi 402898617   356 DGSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWD 396
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSD-DGTIKLWD 40
WD40 pfam00400
WD domain, G-beta repeat;
357-396 8.79e-06

WD domain, G-beta repeat;


Pssm-ID: 249832  Cd Length: 39  Bit Score: 43.50  E-value: 8.79e-06
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 402898617  357 GSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWD 396
Cdd:pfam00400   1 GKLLRTLKGHTGPVTSVAFSPDGNLLASGSD-DGTVRVWD 39
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
137-482 6.35e-23

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 100.55  E-value: 6.35e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 137 AAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELyhdgeqveyaEMVP 216
Cdd:COG2319   33 LGSSESGILLLALLSDSLVSLPDLSSLLLRGHEDSITSIAFSPDGELLLSGSSDGTIKLWDLDNGE----------KLIK 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 217 VLRMVEGDTIYDYCWYSlmssaqPDTSYVAS--SSRENPIHIWDaFTGELRASFRAYNHLDELTaahSLCFSPDGSQLFC 294
Cdd:COG2319  103 SLEGLHDSSVSKLALSS------PDGNSILLasSSLDGTVKLWD-LSTPGKLIRTLEGHSESVT---SLAFSPDGKLLAS 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 295 G--FNRTVRVFSTARPgrdcEVRATFAkkqGQSGIISCIAFSPAQPLY-ACGSYGRSLGLYAWGDGSPLA-LLGGHQGGI 370
Cdd:COG2319  173 GssLDGTIKLWDLRTG----KPLSTLA---GHTDPVSSLAFSPDGGLLiASGSSDGTIRLWDLSTGKLLRsTLSGHSDSV 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 371 THlCFHPDGNRFFSGARkDAELLCWDLRQPGYPLWSLGREvttNQRIY-FDLDPTGQFLVSGSTSGAVSVWDTggpgNDG 449
Cdd:COG2319  246 VS-SFSPDGSLLASGSS-DGTIRLWDLRSSSSLLRTLSGH---SSSVLsVAFSPDGKLLASGSSDGTVRLWDL----ETG 316
                        330       340       350
                 ....*....|....*....|....*....|...
gi 402898617 450 KPESMLSFLPQNDCTNGVSLHPSLPLLATASGQ 482
Cdd:COG2319  317 KLLSSLTLKGHEGPVSSLSFSPDGSLLVSGGSD 349
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
180-491 1.25e-05

protein SPA1-RELATED; Provisional


Pssm-ID: 177776 [Multi-domain]  Cd Length: 793  Bit Score: 46.62  E-value: 1.25e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 180 DGSCILTNSADNILRIYNLPpELYHDGEQVEYaemvPVLRMVEGDTIYDYCWYSLMSSAqpdtsyVASSSRENPIHIWDA 259
Cdd:PLN00181 494 DGEFFATAGVNKKIKIFECE-SIIKDGRDIHY----PVVELASRSKLSGICWNSYIKSQ------VASSNFEGVVQVWDV 562
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 260 FTGELRASFRAYNHldeltaahslcfspdgsqlfcgfnrtvRVFStarpgrdcevratfakkqgqsgiiscIAFSPAQP- 338
Cdd:PLN00181 563 ARSQLVTEMKEHEK---------------------------RVWS--------------------------IDYSSADPt 589
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 339 LYACGSYGRSLGLYAWGDGSPLALLGGhQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQPGYPLWSL-GREVTTNQRI 417
Cdd:PLN00181 590 LLASGSDDGSVKLWSINQGVSIGTIKT-KANICCVQFPSESGRSLAFGSADHKVYYYDLRNPKLPLCTMiGHSKTVSYVR 668
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 418 YFDldptGQFLVSGSTSGAVSVWDTGGPGNDGKPESMLSFLPQNDCTNGVSLHPSLPLLATASG-------QRVFPEPTE 490
Cdd:PLN00181 669 FVD----SSTLVSSSTDNTLKLWDLSMSISGINETPLHSFMGHTNVKNFVGLSVSDGYIATGSEtnevfvyHKAFPMPVL 744

                 .
gi 402898617 491 S 491
Cdd:PLN00181 745 S 745
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
15-138 6.26e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 37.91  E-value: 6.26e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617  15 PSDQDPAPAHPSPHASPmDKNADPELMPPPLEREDPPRLSPDPVAGSAVSQELGEGDPVSLSTPlETEFGAPSELSPQIE 94
Cdd:PRK07003 420 ATRAEAPPAAPAPPATA-DRGDDAADGDAPVPAKANARASADSRCDERDAQPPADSGSASAPAS-DAPPDAAFEPAPRAA 497
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 402898617  95 EQelSENTRLPAEEANGSLSEEEANRPELGSEEAMEDASGEPAA 138
Cdd:PRK07003 498 AP--SAATPAAVPDARAPAAASREDAPAAAAPPAPEARPPTPAA 539
DUF4139 pfam13598
Domain of unknown function (DUF4139); This family is usually found at the C-terminus of ...
63-152 7.61e-03

Domain of unknown function (DUF4139); This family is usually found at the C-terminus of proteins.


Pssm-ID: 257913 [Multi-domain]  Cd Length: 316  Bit Score: 37.25  E-value: 7.61e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617   63 VSQELGE---GDPVSLSTPLETEFGAPSELSPQI----EEQELSENTRLPAEEANGSLSEEEANRPELGSEEAMEDASGE 135
Cdd:pfam13598  35 VRQRTGEdwnDVDLTLSTARPGRGGSPPELSPWRvdlyRPRPPPRLARRAAPMARAAAMAAMAAAEAAAAAAVAEEAPVA 114
                          90
                  ....*....|....*..
gi 402898617  136 PAAEDEGDTAWNYSFSQ 152
Cdd:pfam13598 115 TAEVEESGLSVTFRIPG 131
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
175-480 8.77e-33

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 126.30  E-value: 8.77e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 175 CKWAPDGSCILTNSADNILRIYNLPPELYHDGEQVEYAEMVPVlrmvegdtiydycwyslmsSAQPDTSYVASSSRENPI 254
Cdd:cd00200   15 VAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDV-------------------AASADGTYLASGSSDKTI 75
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 255 HIWDAFTGELRASFRAynHLDELTaahSLCFSPDGSQLF-CGFNRTVRVFSTarpgRDCEVRATFakkQGQSGIISCIAF 333
Cdd:cd00200   76 RLWDLETGECVRTLTG--HTSYVS---SVAFSPDGRILSsSSRDKTIKVWDV----ETGKCLTTL---RGHTDWVNSVAF 143
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 334 SPAQPLYACGSYGRSLGLYAWGDGSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWDLRQpgyplwslGREVTT 413
Cdd:cd00200  144 SPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSS-DGTIKLWDLST--------GKCLGT 214
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 402898617 414 ----NQRIYF-DLDPTGQFLVSGSTSGAVSVWDTggpgNDGKPESMLSfLPQNDCTnGVSLHPSLPLLATAS 480
Cdd:cd00200  215 lrghENGVNSvAFSPDGYLLASGSEDGTIRVWDL----RTGECVQTLS-GHTNSVT-SLAWSPDGKRLASGS 280
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
146-441 2.88e-32

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 124.75  E-value: 2.88e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 146 WNYSFSQLPRFLSGswsefstqPENFLKGCKWAPDGSCILTNSADNILRIYNLppelyhdgeqveyaEMVPVLRMVEGDT 225
Cdd:cd00200   36 WDLETGELLRTLKG--------HTGPVRDVAASADGTYLASGSSDKTIRLWDL--------------ETGECVRTLTGHT 93
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 226 IYdycWYSLMSSaqPDTSYVASSSRENPIHIWDAFTGELRASFRAynHLDeltAAHSLCFSPDGSQLFCG-FNRTVRVFS 304
Cdd:cd00200   94 SY---VSSVAFS--PDGRILSSSSRDKTIKVWDVETGKCLTTLRG--HTD---WVNSVAFSPDGTFVASSsQDGTIKLWD 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 305 TarpgRDCEVRATFakkQGQSGIISCIAFSPAQPLYACGSYGRSLGLYAWGDGSPLALLGGHQGGITHLCFHPDGnRFFS 384
Cdd:cd00200  164 L----RTGKCVATL---TGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGHENGVNSVAFSPDG-YLLA 235
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 402898617 385 GARKDAELLCWDLRqpgyplwsLGREVTT----NQRIY-FDLDPTGQFLVSGSTSGAVSVWD 441
Cdd:cd00200  236 SGSEDGTIRVWDLR--------TGECVQTlsghTNSVTsLAWSPDGKRLASGSADGTIRIWD 289
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
273-481 4.07e-20

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 89.70  E-value: 4.07e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 273 HLDELTaahSLCFSPDGSQLF-CGFNRTVRVFSTArpgrDCEVRATFakkQGQSGIISCIAFSPAQPLYACGSYGRSLGL 351
Cdd:cd00200    8 HTGGVT---CVAFSPDGKLLAtGSGDGTIKVWDLE----TGELLRTL---KGHTGPVRDVAASADGTYLASGSSDKTIRL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 352 YAWGDGSPLALLGGHQGGITHLCFHPDGnRFFSGARKDAELLCWDLRQpgyplwslGREVTT----NQRIYF-DLDPTGQ 426
Cdd:cd00200   78 WDLETGECVRTLTGHTSYVSSVAFSPDG-RILSSSSRDKTIKVWDVET--------GKCLTTlrghTDWVNSvAFSPDGT 148
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 402898617 427 FLVSGSTSGAVSVWDTggpgNDGKPesMLSFLPQNDCTNGVSLHPSLPLLATASG 481
Cdd:cd00200  149 FVASSSQDGTIKLWDL----RTGKC--VATLTGHTGEVNSVAFSPDGEKLLSSSS 197
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
322-480 4.40e-15

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 74.68  E-value: 4.40e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 322 QGQSGIISCIAFSPAQPLYACGSYGRSLGLYAWGDGSPLALLGGHQGGITHLCFHPDGNRFFSGArKDAELLCWDLRQpg 401
Cdd:cd00200    6 KGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTYLASGS-SDKTIRLWDLET-- 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 402 yplwslGREVTT----NQRIY-FDLDPTGQFLVSGSTSGAVSVWDTggpgNDGKPESmlSFLPQNDCTNGVSLHPSLPLL 476
Cdd:cd00200   83 ------GECVRTltghTSYVSsVAFSPDGRILSSSSRDKTIKVWDV----ETGKCLT--TLRGHTDWVNSVAFSPDGTFV 150

                 ....
gi 402898617 477 ATAS 480
Cdd:cd00200  151 ASSS 154
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
143-304 2.73e-11

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 63.12  E-value: 2.73e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 143 DTAWNYSFSQLPRFLSGS--------WSEFSTQPENFLKG-------CKWAPDGSCILTNSADNILRIYNLppelyHDGE 207
Cdd:cd00200  136 DWVNSVAFSPDGTFVASSsqdgtiklWDLRTGKCVATLTGhtgevnsVAFSPDGEKLLSSSSDGTIKLWDL-----STGK 210
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 208 QVEyaemvpVLRmveGDTiyDYCWySLMSSaqPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHldeltAAHSLCFSP 287
Cdd:cd00200  211 CLG------TLR---GHE--NGVN-SVAFS--PDGYLLASGSEDGTIRVWDLRTGECVQTLSGHTN-----SVTSLAWSP 271
                        170
                 ....*....|....*...
gi 402898617 288 DGSQLF-CGFNRTVRVFS 304
Cdd:cd00200  272 DGKRLAsGSADGTIRIWD 289
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
363-483 2.13e-08

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121 [Multi-domain]  Cd Length: 289  Bit Score: 54.26  E-value: 2.13e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 363 LGGHQGGITHLCFHPDGNRFFSGARkDAELLCWDLrQPGYPLWSLgrEVTTNQRIYFDLDPTGQFLVSGSTSGAVSVWDT 442
Cdd:cd00200    5 LKGHTGGVTCVAFSPDGKLLATGSG-DGTIKVWDL-ETGELLRTL--KGHTGPVRDVAASADGTYLASGSSDKTIRLWDL 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 402898617 443 ggpgNDGKPESmlSFLPQNDCTNGVSLHPSLPLLATASGQR 483
Cdd:cd00200   81 ----ETGECVR--TLTGHTSYVSSVAFSPDGRILSSSSRDK 115
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
356-396 3.18e-06

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 44.61  E-value: 3.18e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
gi 402898617   356 DGSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWD 396
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSD-DGTIKLWD 40
WD40 pfam00400
WD domain, G-beta repeat;
357-396 8.79e-06

WD domain, G-beta repeat;


Pssm-ID: 249832  Cd Length: 39  Bit Score: 43.50  E-value: 8.79e-06
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 402898617  357 GSPLALLGGHQGGITHLCFHPDGNRFFSGARkDAELLCWD 396
Cdd:pfam00400   1 GKLLRTLKGHTGPVTSVAFSPDGNLLASGSD-DGTVRVWD 39
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
137-482 6.35e-23

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 100.55  E-value: 6.35e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 137 AAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELyhdgeqveyaEMVP 216
Cdd:COG2319   33 LGSSESGILLLALLSDSLVSLPDLSSLLLRGHEDSITSIAFSPDGELLLSGSSDGTIKLWDLDNGE----------KLIK 102
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 217 VLRMVEGDTIYDYCWYSlmssaqPDTSYVAS--SSRENPIHIWDaFTGELRASFRAYNHLDELTaahSLCFSPDGSQLFC 294
Cdd:COG2319  103 SLEGLHDSSVSKLALSS------PDGNSILLasSSLDGTVKLWD-LSTPGKLIRTLEGHSESVT---SLAFSPDGKLLAS 172
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 295 G--FNRTVRVFSTARPgrdcEVRATFAkkqGQSGIISCIAFSPAQPLY-ACGSYGRSLGLYAWGDGSPLA-LLGGHQGGI 370
Cdd:COG2319  173 GssLDGTIKLWDLRTG----KPLSTLA---GHTDPVSSLAFSPDGGLLiASGSSDGTIRLWDLSTGKLLRsTLSGHSDSV 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 371 THlCFHPDGNRFFSGARkDAELLCWDLRQPGYPLWSLGREvttNQRIY-FDLDPTGQFLVSGSTSGAVSVWDTggpgNDG 449
Cdd:COG2319  246 VS-SFSPDGSLLASGSS-DGTIRLWDLRSSSSLLRTLSGH---SSSVLsVAFSPDGKLLASGSSDGTVRLWDL----ETG 316
                        330       340       350
                 ....*....|....*....|....*....|...
gi 402898617 450 KPESMLSFLPQNDCTNGVSLHPSLPLLATASGQ 482
Cdd:COG2319  317 KLLSSLTLKGHEGPVSSLSFSPDGSLLVSGGSD 349
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
168-480 1.75e-19

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 90.15  E-value: 1.75e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 168 PENFLKGCKWAPDGSCILTNS-ADNILRIYNLPPElyhdgeqveyaemvPVLRMVEGDTiydyCWYSLMSSAQPDTSYVA 246
Cdd:COG2319  154 HSESVTSLAFSPDGKLLASGSsLDGTIKLWDLRTG--------------KPLSTLAGHT----DPVSSLAFSPDGGLLIA 215
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 247 SSSRENPIHIWDAFTGELRASfraynHLDELTAAHSLCFSPDGSQLFCGF-NRTVRVFSTARPGRDcevratFAKKQGQS 325
Cdd:COG2319  216 SGSSDGTIRLWDLSTGKLLRS-----TLSGHSDSVVSSFSPDGSLLASGSsDGTIRLWDLRSSSSL------LRTLSGHS 284
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 326 GIISCIAFSPAQPLYACGSYGRSLGLY--AWGDGSPLALLGGHQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQpGYP 403
Cdd:COG2319  285 SSVLSVAFSPDGKLLASGSSDGTVRLWdlETGKLLSSLTLKGHEGPVSSLSFSPDGSLLVSGGSDDGTIRLWDLRT-GKP 363
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 404 LWSLGREVTTNQriyFDLDPTGQFLVSGSTSGAVSVWDTggpgndgkpeSMLSFLPQNDCTNG----VSLHPSLPLLATA 479
Cdd:COG2319  364 LKTLEGHSNVLS---VSFSPDGRVVSSGSTDGTVRLWDL----------STGSLLRNLDGHTSrvtsLDFSPDGKSLASG 430

                 .
gi 402898617 480 S 480
Cdd:COG2319  431 S 431
COG2319 COG2319
FOG: WD40 repeat [General function prediction only]
146-441 1.42e-18

FOG: WD40 repeat [General function prediction only]


Pssm-ID: 225201 [Multi-domain]  Cd Length: 466  Bit Score: 87.45  E-value: 1.42e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 146 WNYSFSQLPRFLSGSwsefstqpENFLKGCKWAPDGSC-ILTNSADNILRIYNLppelyHDGEQVEyaemvpvlrmvegd 224
Cdd:COG2319  183 WDLRTGKPLSTLAGH--------TDPVSSLAFSPDGGLlIASGSSDGTIRLWDL-----STGKLLR-------------- 235
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 225 TIYDYCWYSLMSSAQPDTSYVASSSRENPIHIWDAFTGElRASFRAYNHLDELTaahSLCFSPDGSQLFCGFN-RTVRVF 303
Cdd:COG2319  236 STLSGHSDSVVSSFSPDGSLLASGSSDGTIRLWDLRSSS-SLLRTLSGHSSSVL---SVAFSPDGKLLASGSSdGTVRLW 311
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 304 STARPGRDCEVratfaKKQGQSGIISCIAFSP-AQPLYACGSYGRSLGLYAWGDGSPLALLGGHqGGITHLCFHPDGnRF 382
Cdd:COG2319  312 DLETGKLLSSL-----TLKGHEGPVSSLSFSPdGSLLVSGGSDDGTIRLWDLRTGKPLKTLEGH-SNVLSVSFSPDG-RV 384
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 383 FSGARKDAELLCWDLRqpgyPLWSLGREVTTNQRIY-FDLDPTGQFLVSGSTSGAVSVWD 441
Cdd:COG2319  385 VSSGSTDGTVRLWDLS----TGSLLRNLDGHTSRVTsLDFSPDGKSLASGSSDNTIRLWD 440
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
180-491 1.25e-05

protein SPA1-RELATED; Provisional


Pssm-ID: 177776 [Multi-domain]  Cd Length: 793  Bit Score: 46.62  E-value: 1.25e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 180 DGSCILTNSADNILRIYNLPpELYHDGEQVEYaemvPVLRMVEGDTIYDYCWYSLMSSAqpdtsyVASSSRENPIHIWDA 259
Cdd:PLN00181 494 DGEFFATAGVNKKIKIFECE-SIIKDGRDIHY----PVVELASRSKLSGICWNSYIKSQ------VASSNFEGVVQVWDV 562
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 260 FTGELRASFRAYNHldeltaahslcfspdgsqlfcgfnrtvRVFStarpgrdcevratfakkqgqsgiiscIAFSPAQP- 338
Cdd:PLN00181 563 ARSQLVTEMKEHEK---------------------------RVWS--------------------------IDYSSADPt 589
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 339 LYACGSYGRSLGLYAWGDGSPLALLGGhQGGITHLCFHPDGNRFFSGARKDAELLCWDLRQPGYPLWSL-GREVTTNQRI 417
Cdd:PLN00181 590 LLASGSDDGSVKLWSINQGVSIGTIKT-KANICCVQFPSESGRSLAFGSADHKVYYYDLRNPKLPLCTMiGHSKTVSYVR 668
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617 418 YFDldptGQFLVSGSTSGAVSVWDTGGPGNDGKPESMLSFLPQNDCTNGVSLHPSLPLLATASG-------QRVFPEPTE 490
Cdd:PLN00181 669 FVD----SSTLVSSSTDNTLKLWDLSMSISGINETPLHSFMGHTNVKNFVGLSVSDGYIATGSEtnevfvyHKAFPMPVL 744

                 .
gi 402898617 491 S 491
Cdd:PLN00181 745 S 745
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
15-138 6.26e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 37.91  E-value: 6.26e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617  15 PSDQDPAPAHPSPHASPmDKNADPELMPPPLEREDPPRLSPDPVAGSAVSQELGEGDPVSLSTPlETEFGAPSELSPQIE 94
Cdd:PRK07003 420 ATRAEAPPAAPAPPATA-DRGDDAADGDAPVPAKANARASADSRCDERDAQPPADSGSASAPAS-DAPPDAAFEPAPRAA 497
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 402898617  95 EQelSENTRLPAEEANGSLSEEEANRPELGSEEAMEDASGEPAA 138
Cdd:PRK07003 498 AP--SAATPAAVPDARAPAAASREDAPAAAAPPAPEARPPTPAA 539
DUF4139 pfam13598
Domain of unknown function (DUF4139); This family is usually found at the C-terminus of ...
63-152 7.61e-03

Domain of unknown function (DUF4139); This family is usually found at the C-terminus of proteins.


Pssm-ID: 257913 [Multi-domain]  Cd Length: 316  Bit Score: 37.25  E-value: 7.61e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402898617   63 VSQELGE---GDPVSLSTPLETEFGAPSELSPQI----EEQELSENTRLPAEEANGSLSEEEANRPELGSEEAMEDASGE 135
Cdd:pfam13598  35 VRQRTGEdwnDVDLTLSTARPGRGGSPPELSPWRvdlyRPRPPPRLARRAAPMARAAAMAAMAAAEAAAAAAVAEEAPVA 114
                          90
                  ....*....|....*..
gi 402898617  136 PAAEDEGDTAWNYSFSQ 152
Cdd:pfam13598 115 TAEVEESGLSVTFRIPG 131
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH