NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|402869528|ref|XP_003898807|]
View 

PREDICTED: amphiregulin isoform X1 [Papio anubis]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PHA02887 super family cl20100
EGF-like protein; Provisional
146-186 7.39e-08

EGF-like protein; Provisional


The actual alignment was detected with superfamily member PHA02887:

Pssm-ID: 165214  Cd Length: 126  Bit Score: 48.77  E-value: 7.39e-08
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|.
gi 402869528 146 CNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSM 186
Cdd:PHA02887  86 CKNDFNDFCINGECMNIIDLDEKFCICNKGYTGIRCDEVSI 126
 
Name Accession Description Interval E-value
PHA02887 PHA02887
EGF-like protein; Provisional
146-186 7.39e-08

EGF-like protein; Provisional


Pssm-ID: 165214  Cd Length: 126  Bit Score: 48.77  E-value: 7.39e-08
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|.
gi 402869528 146 CNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSM 186
Cdd:PHA02887  86 CKNDFNDFCINGECMNIIDLDEKFCICNKGYTGIRCDEVSI 126
 
Name Accession Description Interval E-value
PHA02887 PHA02887
EGF-like protein; Provisional
146-186 7.39e-08

EGF-like protein; Provisional


Pssm-ID: 165214  Cd Length: 126  Bit Score: 48.77  E-value: 7.39e-08
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|.
gi 402869528 146 CNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSM 186
Cdd:PHA02887  86 CKNDFNDFCINGECMNIIDLDEKFCICNKGYTGIRCDEVSI 126
PHA03099 PHA03099
epidermal growth factor-like protein (EGF-like protein); Provisional
146-181 1.93e-03

epidermal growth factor-like protein (EGF-like protein); Provisional


Pssm-ID: 165381  Cd Length: 139  Bit Score: 36.15  E-value: 1.93e-03
                         10        20        30
                 ....*....|....*....|....*....|....*.
gi 402869528 146 CNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERC 181
Cdd:PHA03099  45 CGPEGDGYCLHGDCIHARDIDGMYCRCSHGYTGIRC 80
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH