NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|402861017|ref|XP_003894909.1|]
View 

PREDICTED: MDS1 and EVI1 complex locus protein EVI1 isoform X7 [Papio anubis]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
zf-H2C2_2 pfam13465
Zinc-finger double domain;
738-762 7.70e-06

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 44.31  E-value: 7.70e-06
                           10        20
                   ....*....|....*....|....*
gi 402861017   738 NLTRHLRTHTGEQPYRCKYCDRSFS 762
Cdd:pfam13465    1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
89-113 3.31e-04

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 39.69  E-value: 3.31e-04
                           10        20
                   ....*....|....*....|....*
gi 402861017    89 SLEKHMLSHTEEREYKCDQCPKAFN 113
Cdd:pfam13465    1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
724-746 1.20e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


:

Pssm-ID: 249585  Cd Length: 23  Bit Score: 38.07  E-value: 1.20e-03
                           10        20
                   ....*....|....*....|...
gi 402861017   724 YTCRYCGKIFPRSANLTRHLRTH 746
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
zf-H2C2_2 pfam13465
Zinc-finger double domain;
766-790 5.56e-03

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 36.22  E-value: 5.56e-03
                           10        20
                   ....*....|....*....|....*
gi 402861017   766 NLQRHVRnIHNKEKPFKCHLCDRCF 790
Cdd:pfam13465    1 NLRRHMR-THTGEKPYKCPECGKSF 24
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
103-125 6.65e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


:

Pssm-ID: 249585  Cd Length: 23  Bit Score: 35.76  E-value: 6.65e-03
                           10        20
                   ....*....|....*....|...
gi 402861017   103 YKCDQCPKAFNWKSNLIRHQMSH 125
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
PHA00733 PHA00733
hypothetical protein
657-776 1.36e-04

hypothetical protein


:

Pssm-ID: 177301 [Multi-domain]  Cd Length: 128  Bit Score: 41.78  E-value: 1.36e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402861017  657 EKYLRPSPGFLFHPQMsaienmaEKLESFSALKPEASELLQSVPSMFNFRapPSALPEN------LLRKGKERYTCRYCG 730
Cdd:PHA00733   10 KKYLSNHKGIFIHVTL-------EELKRYHSLTPEQKRLIRAVVKTLIYN--PQLLDESsylyklLTSKAVSPYVCPLCL 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 402861017  731 KIFPRSANLTRHLRthTGEQPYRCKYCDRSFSISSNLQRHVRNIHN 776
Cdd:PHA00733   81 MPFSSSVSLKQHIR--YTEHSKVCPVCGKEFRNTDSTLDHVCKKHN 124
 
Name Accession Description Interval E-value
zf-H2C2_2 pfam13465
Zinc-finger double domain;
738-762 7.70e-06

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 44.31  E-value: 7.70e-06
                           10        20
                   ....*....|....*....|....*
gi 402861017   738 NLTRHLRTHTGEQPYRCKYCDRSFS 762
Cdd:pfam13465    1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
89-113 3.31e-04

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 39.69  E-value: 3.31e-04
                           10        20
                   ....*....|....*....|....*
gi 402861017    89 SLEKHMLSHTEEREYKCDQCPKAFN 113
Cdd:pfam13465    1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
724-746 1.20e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 249585  Cd Length: 23  Bit Score: 38.07  E-value: 1.20e-03
                           10        20
                   ....*....|....*....|...
gi 402861017   724 YTCRYCGKIFPRSANLTRHLRTH 746
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
zf-H2C2_2 pfam13465
Zinc-finger double domain;
766-790 5.56e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 36.22  E-value: 5.56e-03
                           10        20
                   ....*....|....*....|....*
gi 402861017   766 NLQRHVRnIHNKEKPFKCHLCDRCF 790
Cdd:pfam13465    1 NLRRHMR-THTGEKPYKCPECGKSF 24
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
103-125 6.65e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 249585  Cd Length: 23  Bit Score: 35.76  E-value: 6.65e-03
                           10        20
                   ....*....|....*....|...
gi 402861017   103 YKCDQCPKAFNWKSNLIRHQMSH 125
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
PHA00733 PHA00733
hypothetical protein
657-776 1.36e-04

hypothetical protein


Pssm-ID: 177301 [Multi-domain]  Cd Length: 128  Bit Score: 41.78  E-value: 1.36e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402861017  657 EKYLRPSPGFLFHPQMsaienmaEKLESFSALKPEASELLQSVPSMFNFRapPSALPEN------LLRKGKERYTCRYCG 730
Cdd:PHA00733   10 KKYLSNHKGIFIHVTL-------EELKRYHSLTPEQKRLIRAVVKTLIYN--PQLLDESsylyklLTSKAVSPYVCPLCL 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 402861017  731 KIFPRSANLTRHLRthTGEQPYRCKYCDRSFSISSNLQRHVRNIHN 776
Cdd:PHA00733   81 MPFSSSVSLKQHIR--YTEHSKVCPVCGKEFRNTDSTLDHVCKKHN 124
DUF4593 pfam15263
Domain of unknown function (DUF4593); This protein family is a putative uncharacterized ...
296-358 1.79e-03

Domain of unknown function (DUF4593); This protein family is a putative uncharacterized protein family. Its existence is uncertain and its precise function is unknown. This family of proteins is thought to be found in eukaryotes. Proteins in this family are estimated to be around 155 amino acids in length.


Pssm-ID: 259397 [Multi-domain]  Cd Length: 156  Bit Score: 38.85  E-value: 1.79e-03
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 402861017   296 APGFSFSFPGLfPSglyHRPPLIPASSPVKGLSSTEQT--NKSQSPLMTHPQILPATQDILKALS 358
Cdd:pfam15263   73 APDAHLGGPGL-PG---HAGPCGPRARPAQGLAGQEGGagEGPESPAGTLPCSLPASQGIKKGRS 133
SFP1 COG5189
Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division ...
114-207 3.43e-03

Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning];


Pssm-ID: 227516 [Multi-domain]  Cd Length: 423  Bit Score: 39.70  E-value: 3.43e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402861017  114 WKSNLIRHQMSHDSGK--HYECENCAKVFTDPSNLQRHIRSQHV-GARAHACP--ECGKTFATSSGLKQHK-HIHSSV-- 185
Cdd:COG5189   301 IRGGISTGEMIDVRKLpcTNSSSNGKLAHGGERNIDTPSRMLKVkDGKPYKCPveGCNKKYKNQNGLKYHMlHGHQNQkl 380
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 402861017  186 ----------------KPFICEVCHKSYTQFSNLCRHK 207
Cdd:COG5189   381 henpspekmnifsakdKPYRCEVCDKRYKNLNGLKYHR 418
 
Name Accession Description Interval E-value
zf-H2C2_2 pfam13465
Zinc-finger double domain;
738-762 7.70e-06

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 44.31  E-value: 7.70e-06
                           10        20
                   ....*....|....*....|....*
gi 402861017   738 NLTRHLRTHTGEQPYRCKYCDRSFS 762
Cdd:pfam13465    1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-H2C2_2 pfam13465
Zinc-finger double domain;
89-113 3.31e-04

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 39.69  E-value: 3.31e-04
                           10        20
                   ....*....|....*....|....*
gi 402861017    89 SLEKHMLSHTEEREYKCDQCPKAFN 113
Cdd:pfam13465    1 NLRRHMRTHTGEKPYKCPECGKSFS 25
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
724-746 1.20e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 249585  Cd Length: 23  Bit Score: 38.07  E-value: 1.20e-03
                           10        20
                   ....*....|....*....|...
gi 402861017   724 YTCRYCGKIFPRSANLTRHLRTH 746
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
zf-H2C2_2 pfam13465
Zinc-finger double domain;
766-790 5.56e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 36.22  E-value: 5.56e-03
                           10        20
                   ....*....|....*....|....*
gi 402861017   766 NLQRHVRnIHNKEKPFKCHLCDRCF 790
Cdd:pfam13465    1 NLRRHMR-THTGEKPYKCPECGKSF 24
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
103-125 6.65e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 249585  Cd Length: 23  Bit Score: 35.76  E-value: 6.65e-03
                           10        20
                   ....*....|....*....|...
gi 402861017   103 YKCDQCPKAFNWKSNLIRHQMSH 125
Cdd:pfam00096    1 YKCPDCGKSFSRKSNLKRHLRTH 23
zf-BED pfam02892
BED zinc finger;
716-745 7.49e-03

BED zinc finger;


Pssm-ID: 251599  Cd Length: 44  Bit Score: 35.67  E-value: 7.49e-03
                           10        20        30
                   ....*....|....*....|....*....|...
gi 402861017   716 LLRKGKERYTCRYCGKIFPRSA---NLTRHLRT 745
Cdd:pfam02892    9 RVKGGKTKARCKYCGKILSGGSgtsNLKRHLVR 41
PHA00733 PHA00733
hypothetical protein
657-776 1.36e-04

hypothetical protein


Pssm-ID: 177301 [Multi-domain]  Cd Length: 128  Bit Score: 41.78  E-value: 1.36e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402861017  657 EKYLRPSPGFLFHPQMsaienmaEKLESFSALKPEASELLQSVPSMFNFRapPSALPEN------LLRKGKERYTCRYCG 730
Cdd:PHA00733   10 KKYLSNHKGIFIHVTL-------EELKRYHSLTPEQKRLIRAVVKTLIYN--PQLLDESsylyklLTSKAVSPYVCPLCL 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
gi 402861017  731 KIFPRSANLTRHLRthTGEQPYRCKYCDRSFSISSNLQRHVRNIHN 776
Cdd:PHA00733   81 MPFSSSVSLKQHIR--YTEHSKVCPVCGKEFRNTDSTLDHVCKKHN 124
DUF4593 pfam15263
Domain of unknown function (DUF4593); This protein family is a putative uncharacterized ...
296-358 1.79e-03

Domain of unknown function (DUF4593); This protein family is a putative uncharacterized protein family. Its existence is uncertain and its precise function is unknown. This family of proteins is thought to be found in eukaryotes. Proteins in this family are estimated to be around 155 amino acids in length.


Pssm-ID: 259397 [Multi-domain]  Cd Length: 156  Bit Score: 38.85  E-value: 1.79e-03
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 402861017   296 APGFSFSFPGLfPSglyHRPPLIPASSPVKGLSSTEQT--NKSQSPLMTHPQILPATQDILKALS 358
Cdd:pfam15263   73 APDAHLGGPGL-PG---HAGPCGPRARPAQGLAGQEGGagEGPESPAGTLPCSLPASQGIKKGRS 133
SFP1 COG5189
Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division ...
114-207 3.43e-03

Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning];


Pssm-ID: 227516 [Multi-domain]  Cd Length: 423  Bit Score: 39.70  E-value: 3.43e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402861017  114 WKSNLIRHQMSHDSGK--HYECENCAKVFTDPSNLQRHIRSQHV-GARAHACP--ECGKTFATSSGLKQHK-HIHSSV-- 185
Cdd:COG5189   301 IRGGISTGEMIDVRKLpcTNSSSNGKLAHGGERNIDTPSRMLKVkDGKPYKCPveGCNKKYKNQNGLKYHMlHGHQNQkl 380
                          90       100       110
                  ....*....|....*....|....*....|....*...
gi 402861017  186 ----------------KPFICEVCHKSYTQFSNLCRHK 207
Cdd:COG5189   381 henpspekmnifsakdKPYRCEVCDKRYKNLNGLKYHR 418
COG5236 COG5236
Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only];
80-167 7.36e-03

Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only];


Pssm-ID: 227561 [Multi-domain]  Cd Length: 493  Bit Score: 38.85  E-value: 7.36e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402861017   80 CDQVFPDLQSLEKHMLShtEEREYKCDQC---PKAFnW-------KSNLIRHQMSHDSGK----HYECENCAKVFTDPSN 145
Cdd:COG5236   159 CHRRCGSLKELKKHYKA--QHGFVLCSECignKKDF-WneirlfrSSTLRDHKNGGLEEEgfkgHPLCIFCKIYFYDDDE 235
                          90       100
                  ....*....|....*....|..
gi 402861017  146 LQRHIRSQHvgARAHACPECGK 167
Cdd:COG5236   236 LRRHCRLRH--EACHICDMVGP 255
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH