NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|402858132|ref|XP_003893577.1|]
View 

PREDICTED: sodium/potassium-transporting ATPase subunit beta-1 [Papio anubis]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Potassium-transporting_ATPase_subunit_beta TIGR01107
Sodium Potassium ATPase beta subunit; This model describes the Na+/K+ ATPase beta subunit in ...
1-303 0e+00

Sodium Potassium ATPase beta subunit; This model describes the Na+/K+ ATPase beta subunit in eukaryotes. Na+/K+ ATPase(also called Sodium-Potassium pump) is intimately associated with the plasma membrane. It couples the energy released by the hydrolysis of ATP to extrude 3 Na+ ions, with the concomitant uptake of 2K+ ions, against their ionic gradients. [Transport and binding proteins, Cations and iron carrying compounds]


:

Pssm-ID: 273446  Cd Length: 290  Bit Score: 521.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132    1 MARGKAKE----EGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPG 76
Cdd:TIGR01107   1 MARGEKKScgqrMGEWKKFIWNPETKEFLGRTGGSWFKILLFYLVFYGCLAGIFIGTIQVMLQTISDFTPKYQDRVASPG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132   77 LTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIfEDCGDvPSEPKERGEFNHERGERKVCRFKLEWL 156
Cdd:TIGR01107  81 LTQRPKVQKLEISFNVSDPSSYEGYVQTLHKFLKPYNDSAQEDKNL-EDCGD-PAEYKQRGPFNAPYGTKKACQFKRDWL 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132  157 GNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPpknesletypgmkyNANVLPVQCTGKRDEDKEKIGNVEYFGLGNsp 236
Cdd:TIGR01107 159 GNCSGLNDPTFGYSEGKPCVIIKMNRIIGFKPKP--------------NPGVPPVDCTGKRDEDDENIGNVEYYPMNG-- 222
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 402858132  237 GFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYS-EKDRFQGRFDVKIEVKS 303
Cdd:TIGR01107 223 GFPLQYFPYYGKKLQPNYLQPLVAVQFTNLTMNTEVRIECKIYGENIAYSnEKDRFQGRVDFKITIKS 290
 
Name Accession Description Interval E-value
Potassium-transporting_ATPase_subunit_beta TIGR01107
Sodium Potassium ATPase beta subunit; This model describes the Na+/K+ ATPase beta subunit in ...
1-303 0e+00

Sodium Potassium ATPase beta subunit; This model describes the Na+/K+ ATPase beta subunit in eukaryotes. Na+/K+ ATPase(also called Sodium-Potassium pump) is intimately associated with the plasma membrane. It couples the energy released by the hydrolysis of ATP to extrude 3 Na+ ions, with the concomitant uptake of 2K+ ions, against their ionic gradients. [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273446  Cd Length: 290  Bit Score: 521.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132    1 MARGKAKE----EGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPG 76
Cdd:TIGR01107   1 MARGEKKScgqrMGEWKKFIWNPETKEFLGRTGGSWFKILLFYLVFYGCLAGIFIGTIQVMLQTISDFTPKYQDRVASPG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132   77 LTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIfEDCGDvPSEPKERGEFNHERGERKVCRFKLEWL 156
Cdd:TIGR01107  81 LTQRPKVQKLEISFNVSDPSSYEGYVQTLHKFLKPYNDSAQEDKNL-EDCGD-PAEYKQRGPFNAPYGTKKACQFKRDWL 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132  157 GNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPpknesletypgmkyNANVLPVQCTGKRDEDKEKIGNVEYFGLGNsp 236
Cdd:TIGR01107 159 GNCSGLNDPTFGYSEGKPCVIIKMNRIIGFKPKP--------------NPGVPPVDCTGKRDEDDENIGNVEYYPMNG-- 222
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 402858132  237 GFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYS-EKDRFQGRFDVKIEVKS 303
Cdd:TIGR01107 223 GFPLQYFPYYGKKLQPNYLQPLVAVQFTNLTMNTEVRIECKIYGENIAYSnEKDRFQGRVDFKITIKS 290
Na_K-ATPase pfam00287
Sodium / potassium ATPase beta chain;
1-298 4.37e-167

Sodium / potassium ATPase beta chain;


Pssm-ID: 249742  Cd Length: 289  Bit Score: 468.81  E-value: 4.37e-167
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132    1 MARGKAKE-----EGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPP 75
Cdd:pfam00287   1 MARLKEKKscsqsMEEWKKFVWNPETGEFLGRTGSSWAKILLFYVVFYGFLAGIFTLTIWVMLQTLDDYTPKYQDRVASP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132   76 GLTQIPQIQK-TEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDmiFEDCGdvPSEPKERGEFNHERGERKVCRFKLE 154
Cdd:pfam00287  81 GLMIRPKVYKgLEISFNVSDPKSWQEYVHTLNEFLEPYNDSKQSGN--FENCT--PGKYFDQGPFGAPNGEKKACQFNRE 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132  155 WLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNesletypgmkYNANVLPVQCTGKRDEDKEKIGNVEYFGLGn 234
Cdd:pfam00287 157 WLGNCSGLNDPTFGYSEGKPCVLIKMNRIIGFKPEPPKN----------YNSTAPPIHCTGKRAEDKDRIGNIEYFPMG- 225
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 402858132  235 sPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSE-KDRFQGRFDVK 298
Cdd:pfam00287 226 -GGFDLMYYPYYGKKLQPNYLQPLVAVKFTNLTRNVEVRVECKIYAENIKNDDpRDRFLGRVEFK 289
 
Name Accession Description Interval E-value
Potassium-transporting_ATPase_subunit_beta TIGR01107
Sodium Potassium ATPase beta subunit; This model describes the Na+/K+ ATPase beta subunit in ...
1-303 0e+00

Sodium Potassium ATPase beta subunit; This model describes the Na+/K+ ATPase beta subunit in eukaryotes. Na+/K+ ATPase(also called Sodium-Potassium pump) is intimately associated with the plasma membrane. It couples the energy released by the hydrolysis of ATP to extrude 3 Na+ ions, with the concomitant uptake of 2K+ ions, against their ionic gradients. [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273446  Cd Length: 290  Bit Score: 521.92  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132    1 MARGKAKE----EGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPG 76
Cdd:TIGR01107   1 MARGEKKScgqrMGEWKKFIWNPETKEFLGRTGGSWFKILLFYLVFYGCLAGIFIGTIQVMLQTISDFTPKYQDRVASPG 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132   77 LTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIfEDCGDvPSEPKERGEFNHERGERKVCRFKLEWL 156
Cdd:TIGR01107  81 LTQRPKVQKLEISFNVSDPSSYEGYVQTLHKFLKPYNDSAQEDKNL-EDCGD-PAEYKQRGPFNAPYGTKKACQFKRDWL 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132  157 GNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPpknesletypgmkyNANVLPVQCTGKRDEDKEKIGNVEYFGLGNsp 236
Cdd:TIGR01107 159 GNCSGLNDPTFGYSEGKPCVIIKMNRIIGFKPKP--------------NPGVPPVDCTGKRDEDDENIGNVEYYPMNG-- 222
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 402858132  237 GFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYS-EKDRFQGRFDVKIEVKS 303
Cdd:TIGR01107 223 GFPLQYFPYYGKKLQPNYLQPLVAVQFTNLTMNTEVRIECKIYGENIAYSnEKDRFQGRVDFKITIKS 290
Na_K-ATPase pfam00287
Sodium / potassium ATPase beta chain;
1-298 4.37e-167

Sodium / potassium ATPase beta chain;


Pssm-ID: 249742  Cd Length: 289  Bit Score: 468.81  E-value: 4.37e-167
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132    1 MARGKAKE-----EGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPP 75
Cdd:pfam00287   1 MARLKEKKscsqsMEEWKKFVWNPETGEFLGRTGSSWAKILLFYVVFYGFLAGIFTLTIWVMLQTLDDYTPKYQDRVASP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132   76 GLTQIPQIQK-TEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDmiFEDCGdvPSEPKERGEFNHERGERKVCRFKLE 154
Cdd:pfam00287  81 GLMIRPKVYKgLEISFNVSDPKSWQEYVHTLNEFLEPYNDSKQSGN--FENCT--PGKYFDQGPFGAPNGEKKACQFNRE 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402858132  155 WLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNesletypgmkYNANVLPVQCTGKRDEDKEKIGNVEYFGLGn 234
Cdd:pfam00287 157 WLGNCSGLNDPTFGYSEGKPCVLIKMNRIIGFKPEPPKN----------YNSTAPPIHCTGKRAEDKDRIGNIEYFPMG- 225
                         250       260       270       280       290       300
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 402858132  235 sPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSE-KDRFQGRFDVK 298
Cdd:pfam00287 226 -GGFDLMYYPYYGKKLQPNYLQPLVAVKFTNLTRNVEVRVECKIYAENIKNDDpRDRFLGRVEFK 289
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH