NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|402855690|ref|XP_003892449|]
View 

PREDICTED: protein Wnt-2b [Papio anubis]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
71-380 5.01e-180

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


:

Pssm-ID: 249596  Cd Length: 308  Bit Score: 506.00  E-value: 5.01e-180
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690   71 ICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDrDHTVFGRVMLRSSREAAFVYAISSAGV 150
Cdd:pfam00110   1 ICSKLPGLSRKQRRLCRRNPDVMASVGEGARLGIEECQHQFRNRRWNCSTLD-SSSVFGKILKRGTRETAFVYAISSAGV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690  151 VHAITRACSQGELSVCSCDPYTRGRHHDqrGDFDWGGCSDNIHYGVRFAKAFVDAKEKRlKDARALMNLHNNRCGRTAVR 230
Cdd:pfam00110  80 VHAVTRACSEGNLESCGCDRSRRGRSGE--GGWEWGGCSDNIKFGIRFSREFLDARERG-RDARALMNLHNNEAGRKAVK 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690  231 RFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFT--AARQGYRRATRTDLVYFDNSPDY 308
Cdd:pfam00110 157 RNMKTECKCHGVSGSCTLKTCWKQLPDFREVGDLLKEKYDGAIKVEVNNRGKRRRlqRRNPKRKPPTSTDLVYLEDSPDY 236
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 402855690  309 CVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 380
Cdd:pfam00110 237 CERNPSLGSLGTRGRECNKTSSGIDGCDLLCCGRGYNTRTVVVVERCNCKFHWCCYVKCKTCRETVEVYTCK 308
 
Name Accession Description Interval E-value
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
71-380 5.01e-180

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


Pssm-ID: 249596  Cd Length: 308  Bit Score: 506.00  E-value: 5.01e-180
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690   71 ICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDrDHTVFGRVMLRSSREAAFVYAISSAGV 150
Cdd:pfam00110   1 ICSKLPGLSRKQRRLCRRNPDVMASVGEGARLGIEECQHQFRNRRWNCSTLD-SSSVFGKILKRGTRETAFVYAISSAGV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690  151 VHAITRACSQGELSVCSCDPYTRGRHHDqrGDFDWGGCSDNIHYGVRFAKAFVDAKEKRlKDARALMNLHNNRCGRTAVR 230
Cdd:pfam00110  80 VHAVTRACSEGNLESCGCDRSRRGRSGE--GGWEWGGCSDNIKFGIRFSREFLDARERG-RDARALMNLHNNEAGRKAVK 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690  231 RFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFT--AARQGYRRATRTDLVYFDNSPDY 308
Cdd:pfam00110 157 RNMKTECKCHGVSGSCTLKTCWKQLPDFREVGDLLKEKYDGAIKVEVNNRGKRRRlqRRNPKRKPPTSTDLVYLEDSPDY 236
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 402855690  309 CVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 380
Cdd:pfam00110 237 CERNPSLGSLGTRGRECNKTSSGIDGCDLLCCGRGYNTRTVVVVERCNCKFHWCCYVKCKTCRETVEVYTCK 308
WNT1 smart00097
found in Wnt-1;
74-380 1.80e-158

found in Wnt-1;


Pssm-ID: 128408  Cd Length: 305  Bit Score: 451.00  E-value: 1.80e-158
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690    74 NIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDrDHTVFGRVMLRSSREAAFVYAISSAGVVHA 153
Cdd:smart00097   1 SLPGLSRRQRRLCRANPDVMISVAEGAQEGIEECQHQFRFRRWNCSTLD-NASVFGKVLRQGTRETAFVYAISSAGVAHA 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690   154 ITRACSQGELSVCSCDPYTRGRhhDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRlKDARALMNLHNNRCGRTAVRRFL 233
Cdd:smart00097  80 VTRACSEGELDSCGCDYRKRGR--AGGRGWKWGGCSDNIDFGIRFSREFVDARERG-KDARALMNLHNNEAGRLAVKKTM 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690   234 KLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQG--YRRATRTDLVYFDNSPDYCVL 311
Cdd:smart00097 157 KRECKCHGVSGSCTVKTCWLQLPDFRKVGDYLKEKYDGASEVEVDKRGTNKAPVPKNstFKPPTETDLVYLESSPDFCEK 236
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 402855690   312 DKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 380
Cdd:smart00097 237 NPKTGSLGTQGRQCNKTSKGLDGCDLLCCGRGYNTRTVEVVERCNCKFHWCCYVKCKQCRETVEKHTCK 305
 
Name Accession Description Interval E-value
wnt pfam00110
wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, ...
71-380 5.01e-180

wnt family; Wnt genes have been identified in vertebrates and invertebrates but not in plants, unicellular eukaryotes or prokaryotes. In humans, 19 WNT proteins are known. Because of their insolubility little is known about Wnt protein structure, but all have 23 or 24 Cys residues whose spacing is highly conserved. Signal transduction by Wnt proteins (including the Wnt/beta-catenin, the Wnt/Ca++, and the Wnt/polarity pathway) is mediated by receptors of the Frizzled and LDL-receptor-related protein (LRP) families.


Pssm-ID: 249596  Cd Length: 308  Bit Score: 506.00  E-value: 5.01e-180
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690   71 ICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDrDHTVFGRVMLRSSREAAFVYAISSAGV 150
Cdd:pfam00110   1 ICSKLPGLSRKQRRLCRRNPDVMASVGEGARLGIEECQHQFRNRRWNCSTLD-SSSVFGKILKRGTRETAFVYAISSAGV 79
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690  151 VHAITRACSQGELSVCSCDPYTRGRHHDqrGDFDWGGCSDNIHYGVRFAKAFVDAKEKRlKDARALMNLHNNRCGRTAVR 230
Cdd:pfam00110  80 VHAVTRACSEGNLESCGCDRSRRGRSGE--GGWEWGGCSDNIKFGIRFSREFLDARERG-RDARALMNLHNNEAGRKAVK 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690  231 RFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFT--AARQGYRRATRTDLVYFDNSPDY 308
Cdd:pfam00110 157 RNMKTECKCHGVSGSCTLKTCWKQLPDFREVGDLLKEKYDGAIKVEVNNRGKRRRlqRRNPKRKPPTSTDLVYLEDSPDY 236
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 402855690  309 CVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 380
Cdd:pfam00110 237 CERNPSLGSLGTRGRECNKTSSGIDGCDLLCCGRGYNTRTVVVVERCNCKFHWCCYVKCKTCRETVEVYTCK 308
WNT1 smart00097
found in Wnt-1;
74-380 1.80e-158

found in Wnt-1;


Pssm-ID: 128408  Cd Length: 305  Bit Score: 451.00  E-value: 1.80e-158
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690    74 NIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDrDHTVFGRVMLRSSREAAFVYAISSAGVVHA 153
Cdd:smart00097   1 SLPGLSRRQRRLCRANPDVMISVAEGAQEGIEECQHQFRFRRWNCSTLD-NASVFGKVLRQGTRETAFVYAISSAGVAHA 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690   154 ITRACSQGELSVCSCDPYTRGRhhDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRlKDARALMNLHNNRCGRTAVRRFL 233
Cdd:smart00097  80 VTRACSEGELDSCGCDYRKRGR--AGGRGWKWGGCSDNIDFGIRFSREFVDARERG-KDARALMNLHNNEAGRLAVKKTM 156
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 402855690   234 KLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQG--YRRATRTDLVYFDNSPDYCVL 311
Cdd:smart00097 157 KRECKCHGVSGSCTVKTCWLQLPDFRKVGDYLKEKYDGASEVEVDKRGTNKAPVPKNstFKPPTETDLVYLESSPDFCEK 236
                          250       260       270       280       290       300
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 402855690   312 DKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCK 380
Cdd:smart00097 237 NPKTGSLGTQGRQCNKTSKGLDGCDLLCCGRGYNTRTVEVVERCNCKFHWCCYVKCKQCRETVEKHTCK 305
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH