NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|38232693|ref|NP_938460|]
View 

phosphoprotein phosphatase [Corynebacterium diphtheriae NCTC 13129]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-227 9.75e-45

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 158.64  E-value: 9.75e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693   6 NYAAASDRGLVRGNNEDSAYAGP-------HLIALADGMGGHAAGEVASQLMINHLMRLD---ADVDDNDMLALLASVAD 75
Cdd:cd00143   1 FSAGVSDKGGDRKTNEDAVVIKPnlnnedgGLFGVFDGHGGHAAGEFASKLLVEELLEELeetLTLSEEDIEEALRKAFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693  76 DANRAIAQGVRDVPETDGMGTTLTALMFNGADLAMCHVGDSRGYRLRDGALEQITVDDTYVQ-SLVDKGQLAPEDVS--T 152
Cdd:cd00143  81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNeEERERIEKAGGRVSngR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693 153 HPQRSMILKA---YTGRP---VEPTLKMIDIRPGDRFL-LCSDGLSDPVTHSTI----ETTLQQGTPQEAARRLVDLALR 221
Cdd:cd00143 161 VPGVLAVTRAlgdFDLKPgvsAEPDVTVVKLTEDDDFLiLASDGLWDVLSNQEAvdivRSELAKEDLQEAAQELVDLALR 240

                ....*.
gi 38232693 222 SGGPDN 227
Cdd:cd00143 241 RGSHDN 246
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-227 9.75e-45

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 158.64  E-value: 9.75e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693   6 NYAAASDRGLVRGNNEDSAYAGP-------HLIALADGMGGHAAGEVASQLMINHLMRLD---ADVDDNDMLALLASVAD 75
Cdd:cd00143   1 FSAGVSDKGGDRKTNEDAVVIKPnlnnedgGLFGVFDGHGGHAAGEFASKLLVEELLEELeetLTLSEEDIEEALRKAFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693  76 DANRAIAQGVRDVPETDGMGTTLTALMFNGADLAMCHVGDSRGYRLRDGALEQITVDDTYVQ-SLVDKGQLAPEDVS--T 152
Cdd:cd00143  81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNeEERERIEKAGGRVSngR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693 153 HPQRSMILKA---YTGRP---VEPTLKMIDIRPGDRFL-LCSDGLSDPVTHSTI----ETTLQQGTPQEAARRLVDLALR 221
Cdd:cd00143 161 VPGVLAVTRAlgdFDLKPgvsAEPDVTVVKLTEDDDFLiLASDGLWDVLSNQEAvdivRSELAKEDLQEAAQELVDLALR 240

                ....*.
gi 38232693 222 SGGPDN 227
Cdd:cd00143 241 RGSHDN 246
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
1-227 2.94e-70

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 226.47  E-value: 2.94e-70
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693   1 MMLRLNYAAASDRGLVRGNNEDSAYAGPH-------LIALADGMGGHAAGEVASQLMINHLMRLDADVDDNDMLA----L 69
Cdd:COG0631   4 GILSLKVAGLSDVGTVRKHNEDAFLIKPNengnlllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNEsleeL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693  70 LASVADDANRAIAQGVRDVPETDGMGTTLTALMFNGADLAMCHVGDSRGYRLRDGALEQITVDDTYVQSLVDKGQLAPED 149
Cdd:COG0631  84 LKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEE 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693 150 VSTHPQRSMILKAY-TGRPVEPTLKMIDIRPGDRFLLCSDGLSDPVTHSTIETTLQ-QGTPQEAARRLVDLALRSGGPDN 227
Cdd:COG0631 164 ARSHPRRNALTRALgDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKnSETPQEAADKLIELALEGGGPDN 243
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
11-227 2.63e-30

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 117.86  E-value: 2.63e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693     11 SDRGLVRGNNEDSAYAGP------HLIALADGMGGHAAGEVASQLMINHLMRLDADVDDNDMLALLAsvADDANRAIAQG 84
Cdd:smart00332  14 SSMQGVRKPMEDAHVITPdlsdsgGFFGVFDGHGGSEAAKFLSKNLPEILAEELIKEKDELEDVEEA--LRKAFLSTDEE 91
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693     85 VRDVPEtDGMGTTLTALMFNGADLAMCHVGDSRGYRLRDGALEQITVDDT-YVQSLVDKGQLAPEDVST--HPQRSMILK 161
Cdd:smart00332  92 ILEELE-ALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKpSNEDERARIEAAGGFVINgrVNGVLALSR 170
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 38232693    162 A---YTGRPV---EPTLKMIDIRP-GDRFLLCSDGLSDPVTHSTIETTLQQGT---PQEAARRLVDLALRSGGPDN 227
Cdd:smart00332 171 AigdFFLKPYvsaEPDVTVVELTEkDDFLILASDGLWDVLSNQEVVDIVRKHLskdPKEAAKRLIDLALARGSKDN 246
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
29-227 1.58e-14

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 72.01  E-value: 1.58e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693    29 HLIALADGMGGHAAGEVASQLMINHLMRLDADVDDNDMLALLASVADDANRAIAQGvRDVPETDGMGTTLTALMFNGADL 108
Cdd:pfam00481  35 SFFAVFDGHGGSEAAKYAGKHLHTILALRRSFLTLRKLEDALRESFLETDEELRSD-AANHEDLSSGSTAVVALIRGNKL 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693   109 AMCHVGDSRGYRLR-DGALEQITVD---------------DTYVqSLVDK--GQLAPE----DVSTHPQRSMILkaytgr 166
Cdd:pfam00481 114 YVANVGDSRAVLCRnGGAIKQLTEDhkpsdederrriraaGGFV-SRNGRvnGVLAVSrafgDFDLKPGEQPVS------ 186
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 38232693   167 pVEPTLKMIDIRPGDRFL-LCSDGLSDPVTHSTIETTLQQ-----GTPQEAARRLVDLALRSGGPDN 227
Cdd:pfam00481 187 -AEPDITSHKITEDDEFLiLACDGLWDVLSDQEVVDIVRSnlsdgGDPMEAAEKLVDEAIAYGSEDN 252
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
8-227 6.91e-26

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 109.76  E-value: 6.91e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693    8 AAASDRGLVRGNNEDsaYAG----------PH--------LIALADGMGGHAAGEVASQLMINHLMRLDADV------DD 63
Cdd:PRK14559 378 AGRTDVGRQRHHNED--YFGintriqklenPHgrivqargLYILCDGMGGHAAGEVASALAVETLQQYFQQHwqdelpDE 455
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693   64 NDML-ALLAsvaddANRAIAQgVRDVPETDG---MGTTLTALMFNGADLAMCHVGDSRGYRL-RDGALEQITVDDTYVQS 138
Cdd:PRK14559 456 ETIReAIYL-----ANEAIYD-LNQQNARSGsgrMGTTLVMALVQDTQVAVAHVGDSRLYRVtRKGGLEQLTVDHEVGQR 529
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693  139 LVDKGqlapedvsTHPQrsmilKAYtGRP----------------VEPTLKMIDIRPGDRFLLCSDGLSDpvtHSTIETT 202
Cdd:PRK14559 530 EIQRG--------VEPQ-----IAY-ARPdayqltqalgprdnsaIQPDIQFLEIEEDTLLLLCSDGLSD---NDLLETH 592
                        250       260       270
                 ....*....|....*....|....*....|....
gi 38232693  203 LQQ--------GTP-QEAARRLVDLALRSGGPDN 227
Cdd:PRK14559 593 WQThllpllssSANlDQGLNKLIDLANQYNGHDN 626
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
6-227 9.75e-45

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 158.64  E-value: 9.75e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693   6 NYAAASDRGLVRGNNEDSAYAGP-------HLIALADGMGGHAAGEVASQLMINHLMRLD---ADVDDNDMLALLASVAD 75
Cdd:cd00143   1 FSAGVSDKGGDRKTNEDAVVIKPnlnnedgGLFGVFDGHGGHAAGEFASKLLVEELLEELeetLTLSEEDIEEALRKAFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693  76 DANRAIAQGVRDVPETDGMGTTLTALMFNGADLAMCHVGDSRGYRLRDGALEQITVDDTYVQ-SLVDKGQLAPEDVS--T 152
Cdd:cd00143  81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNeEERERIEKAGGRVSngR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693 153 HPQRSMILKA---YTGRP---VEPTLKMIDIRPGDRFL-LCSDGLSDPVTHSTI----ETTLQQGTPQEAARRLVDLALR 221
Cdd:cd00143 161 VPGVLAVTRAlgdFDLKPgvsAEPDVTVVKLTEDDDFLiLASDGLWDVLSNQEAvdivRSELAKEDLQEAAQELVDLALR 240

                ....*.
gi 38232693 222 SGGPDN 227
Cdd:cd00143 241 RGSHDN 246
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
1-227 2.94e-70

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 226.47  E-value: 2.94e-70
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693   1 MMLRLNYAAASDRGLVRGNNEDSAYAGPH-------LIALADGMGGHAAGEVASQLMINHLMRLDADVDDNDMLA----L 69
Cdd:COG0631   4 GILSLKVAGLSDVGTVRKHNEDAFLIKPNengnlllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNEsleeL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693  70 LASVADDANRAIAQGVRDVPETDGMGTTLTALMFNGADLAMCHVGDSRGYRLRDGALEQITVDDTYVQSLVDKGQLAPED 149
Cdd:COG0631  84 LKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEE 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693 150 VSTHPQRSMILKAY-TGRPVEPTLKMIDIRPGDRFLLCSDGLSDPVTHSTIETTLQ-QGTPQEAARRLVDLALRSGGPDN 227
Cdd:COG0631 164 ARSHPRRNALTRALgDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKnSETPQEAADKLIELALEGGGPDN 243
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
11-227 2.63e-30

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 117.86  E-value: 2.63e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693     11 SDRGLVRGNNEDSAYAGP------HLIALADGMGGHAAGEVASQLMINHLMRLDADVDDNDMLALLAsvADDANRAIAQG 84
Cdd:smart00332  14 SSMQGVRKPMEDAHVITPdlsdsgGFFGVFDGHGGSEAAKFLSKNLPEILAEELIKEKDELEDVEEA--LRKAFLSTDEE 91
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693     85 VRDVPEtDGMGTTLTALMFNGADLAMCHVGDSRGYRLRDGALEQITVDDT-YVQSLVDKGQLAPEDVST--HPQRSMILK 161
Cdd:smart00332  92 ILEELE-ALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKpSNEDERARIEAAGGFVINgrVNGVLALSR 170
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 38232693    162 A---YTGRPV---EPTLKMIDIRP-GDRFLLCSDGLSDPVTHSTIETTLQQGT---PQEAARRLVDLALRSGGPDN 227
Cdd:smart00332 171 AigdFFLKPYvsaEPDVTVVELTEkDDFLILASDGLWDVLSNQEVVDIVRKHLskdPKEAAKRLIDLALARGSKDN 246
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
11-221 6.11e-24

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 98.57  E-value: 6.11e-24
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693     11 SDRGLVRGNNEDSAY------------AGPHLIALADGMGGHAAGEVASqLMINHLMRLDADVDDNdmlalLASVADDAN 78
Cdd:smart00331   1 DDGGLIAQYYEDATQvggdfydvvklpEGRLLIAIADVMGKGLAAALAM-SMARSALRTLLSEGIS-----LSQILERLN 74
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693     79 RAIAQGvrdvpETDGMGTTLTALMFN--GADLAMCHVGDSRGYRLRDGALEQITVDDTyvqslvdkGQLapedvsthpqr 156
Cdd:smart00331  75 RAIYEN-----GEDGMFATLFLALYDfaGGTLSYANAGHSPPYLLRADGGLVEDLDDL--------GAP----------- 130
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693    157 smilkayTGRPVEPTLKM--IDIRPGDRFLLCSDGLSDPVTHSTIETTLQQGT---PQEAARRLVDLALR 221
Cdd:smart00331 131 -------LGLEPDVEVDVreLTLEPGDLLLLYTDGLTEARNPERLEELLEELLgspPAEIAQRILEELLE 193
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
29-227 1.58e-14

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 72.01  E-value: 1.58e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693    29 HLIALADGMGGHAAGEVASQLMINHLMRLDADVDDNDMLALLASVADDANRAIAQGvRDVPETDGMGTTLTALMFNGADL 108
Cdd:pfam00481  35 SFFAVFDGHGGSEAAKYAGKHLHTILALRRSFLTLRKLEDALRESFLETDEELRSD-AANHEDLSSGSTAVVALIRGNKL 113
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693   109 AMCHVGDSRGYRLR-DGALEQITVD---------------DTYVqSLVDK--GQLAPE----DVSTHPQRSMILkaytgr 166
Cdd:pfam00481 114 YVANVGDSRAVLCRnGGAIKQLTEDhkpsdederrriraaGGFV-SRNGRvnGVLAVSrafgDFDLKPGEQPVS------ 186
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 38232693   167 pVEPTLKMIDIRPGDRFL-LCSDGLSDPVTHSTIETTLQQ-----GTPQEAARRLVDLALRSGGPDN 227
Cdd:pfam00481 187 -AEPDITSHKITEDDEFLiLACDGLWDVLSDQEVVDIVRSnlsdgGDPMEAAEKLVDEAIAYGSEDN 252
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
19-218 3.51e-13

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 67.34  E-value: 3.51e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693    19 NNEDSAYA----GPHLIALADGMGGHAAGEVASQL----MINHLMRLDADVDDNDMLALLASVADDANRAIAQ--GVRDV 88
Cdd:pfam13672  11 PCQDAFAYrvlsDGWLIAVADGAGSAKYSDVGARLaveaAVEALRELLDSGELPELEALVRQILNDILALVRQeaAAQGL 90
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693    89 PETDgMGTTLTALMFNGADLAMCHVGDSR-GYRLRDGALEQITVDDtyvqslvdKGQLAPEDVSThpqrsmilkayTGRP 167
Cdd:pfam13672  91 EPRD-YATTLLLAVITPGGIVFFQIGDGAiVVRDRDGELQLLSEPD--------SGEYANETTFL-----------TSPD 150
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*...
gi 38232693   168 VEPTLKM--IDIRPGDRFLLCSDGLSDPVTHST-----IETTLQQGTPQEAARRLVDL 218
Cdd:pfam13672 151 ALEEFRIrrLTLEPGDALALMTDGLSDSLVTEEpffpfFAPLLETLEEEGASEQLAEF 208
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
30-226 1.47e-04

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 41.51  E-value: 1.47e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693    30 LIALADGMG-GHAAGEVASQL--MINHLMRLDADvddndmlalLASVADDANRAIAQGVRDvpetdGMGTTLTALMFN-- 104
Cdd:pfam07228   6 ALVIGDVMGhGLPAALLMGMLrtALRALALEGLD---------PAEVLERLNRALQRNLEG-----ERFATAVLAVYDpe 71
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693   105 GADLAMCHVGDSRGYRLRDgaleqitvDDTYVQSLVDKGqlapedvsthpqrsMILKAYTGRPVEPTLkmIDIRPGDRFL 184
Cdd:pfam07228  72 TGTLEYANAGHPPPLLLRP--------DGGVVELLESPG--------------LPLGVLPDAPYETAE--FPLEPGDTLL 127
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 38232693   185 LCSDGL---SDPVTHSTIETTLQQ-------GTPQEAARRLVDLALRSGGPD 226
Cdd:pfam07228 128 LYTDGLteaRDPDGELFGLERLLAllaerhgLSPEELLDALLEDLLRLGGGE 179
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
8-227 6.91e-26

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 109.76  E-value: 6.91e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693    8 AAASDRGLVRGNNEDsaYAG----------PH--------LIALADGMGGHAAGEVASQLMINHLMRLDADV------DD 63
Cdd:PRK14559 378 AGRTDVGRQRHHNED--YFGintriqklenPHgrivqargLYILCDGMGGHAAGEVASALAVETLQQYFQQHwqdelpDE 455
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693   64 NDML-ALLAsvaddANRAIAQgVRDVPETDG---MGTTLTALMFNGADLAMCHVGDSRGYRL-RDGALEQITVDDTYVQS 138
Cdd:PRK14559 456 ETIReAIYL-----ANEAIYD-LNQQNARSGsgrMGTTLVMALVQDTQVAVAHVGDSRLYRVtRKGGLEQLTVDHEVGQR 529
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 38232693  139 LVDKGqlapedvsTHPQrsmilKAYtGRP----------------VEPTLKMIDIRPGDRFLLCSDGLSDpvtHSTIETT 202
Cdd:PRK14559 530 EIQRG--------VEPQ-----IAY-ARPdayqltqalgprdnsaIQPDIQFLEIEEDTLLLLCSDGLSD---NDLLETH 592
                        250       260       270
                 ....*....|....*....|....*....|....
gi 38232693  203 LQQ--------GTP-QEAARRLVDLALRSGGPDN 227
Cdd:PRK14559 593 WQThllpllssSANlDQGLNKLIDLANQYNGHDN 626
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH