NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|37523747|ref|NP_927124|]
View 

hypothetical protein glr4178 [Gloeobacter violaceus PCC 7421]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
AarF COG0661
Predicted unusual protein kinase [General function prediction only]
40-564 2.71e-174

Predicted unusual protein kinase [General function prediction only]


:

Pssm-ID: 223733  Cd Length: 517  Bit Score: 507.62  E-value: 2.71e-174
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747  40 YRWNRVNYSRTRRVIDIWGFFLLILFYRWWDSKKWTYRSGDSEENRSRRQRMRAIWTRETMLELGPTFIKVGQLFSTRAD 119
Cdd:COG0661   5 YAVSRLPRIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLASSEELREKRAERLRLALEELGPTFIKLGQILSTRPD 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 120 LFPKEYIEELSRLQDEVPAFPYEQVVEIVEDQFGKPIPQVFQFFDPTPIAAASLGQVHRAQLHSGEDVVVKVQRPGLEKL 199
Cdd:COG0661  85 LVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRER 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 200 FNVDLGILRGIAQYLQNHPRYGRGgREWVPIYDECARILMQEIDYLNEGRNADTFRRNFKDSPEICVPRVYWRYSSPRVL 279
Cdd:COG0661 165 IEADLKLLRRLARLIKRLPPGGRR-LDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRVL 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 280 TLEYLPGIKISNYEALEAAGLDRRSLARIGARSYLQQLLNDGFFHADPHPGNIAVRHDGALIFYDFGMMGHIQPGTKEKL 359
Cdd:COG0661 244 TMEWIDGIKISDIAALKSAGIDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRSDGRIVLLDFGIVGRLDPKFRRYL 323
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 360 MDTFLGVAQSDADKVIDSLIELGAIKKSADRVPIRRSIEFLLTNFVNQPynLQSFNFAELTDDIYEMAYEQPFRFPATFT 439
Cdd:COG0661 324 AELLLAFLNRDYDRVAELHVELGYVPPDTDRDPLAAAIRAVLEPIYGKP--LEEISFGEILDKLFEVARRFPMRLPPELV 401
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 440 FVLRAVSTLEGLGKGLDPDFNFMDVAQPFADQLMaVNSEFgmRELFNQLGQQVGQVSSMTVNLPRRIEQTLeraDRGELR 519
Cdd:COG0661 402 LLQRTLLLVEGVGRQLDPRFNLWAVAQPLLAKWL-KKQLS--PKLLRELKDEAVAVLNALPLLPRLLRDLL---DNDREE 475
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....*
gi 37523747 520 VRTKSIETERLLKRLNSAAiggiYSVLLAAFLICSVVLYTADHIL 564
Cdd:COG0661 476 LSLRSSEELALLLLKAVAR----LSIGSILLVVLAVTVLLIAILL 516
UbiB TIGR01982
2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the ...
84-484 3.34e-124

2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].


:

Pssm-ID: 233667 [Multi-domain]  Cd Length: 437  Bit Score: 376.25  E-value: 3.34e-124
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747    84 NRSRRQRMRAIWTRETMLELGPTFIKVGQLFSTRADLFPKEYIEELSRLQDEVPAFPYEQVVEIVEDQFGKPIPQVFQFF 163
Cdd:TIGR01982  41 NRENRLMSRGERLRLALEELGPTFIKFGQTLSTRADLLPADIAEELSLLQDRVPPFDFKVARKVIEAALGGPLEELFAEF 120
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   164 DPTPIAAASLGQVHRAQLHSGEDVVVKVQRPGLEKLFNVDLGILRGIAQYLQNHPRYGRGGREwVPIYDECARILMQEID 243
Cdd:TIGR01982 121 EEKPLAAASIAQVHRARLVDGKEVAVKVLRPGIEKTIAADIALLYRLARIVERLSPDSRRLRP-TEVVKEFEKTLRRELD 199
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   244 YLNEGRNADTFRRNFKDSPEICVPRVYWRYSSPRVLTLEYLPGIKISNYEALEAAGLDRRSLARIGARSYLQQLLNDGFF 323
Cdd:TIGR01982 200 LRREAANASELGENFKNDPGVYVPEVYWDRTSERVLTMEWIDGIPLSDIAALDEAGLDRKALAENLARSFLNQVLRDGFF 279
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   324 HADPHPGNIAVRHDGALIFYDFGMMGHIQPGTKEKLMDTFLGVAQSDADKVIDSLIELGAIKKSADRVPIRRSIEFLLTN 403
Cdd:TIGR01982 280 HADLHPGNIFVLKDGKIIALDFGIVGRLSEEDRRYLAEILYGFLNRDYRRVAEVHFDAGYVPSDTDMAEFEQAIRAIGEP 359
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   404 FVNQPynLQSFNFAELTDDIYEMAYEQPFRFPATFTFVLRAVSTLEGLGKGLDPDFNFMDVAQPFADQLMavNSEFGMRE 483
Cdd:TIGR01982 360 IFGQP--LKEISVGRLLAGLFKITRDFNMELQPQLLLLQKTLLTVEGVGRQLDPDLNMWKVAEPFVKRWI--RKRLGPKA 435

                  .
gi 37523747   484 L 484
Cdd:TIGR01982 436 K 436
 
Name Accession Description Interval E-value
AarF COG0661
Predicted unusual protein kinase [General function prediction only]
40-564 2.71e-174

Predicted unusual protein kinase [General function prediction only]


Pssm-ID: 223733  Cd Length: 517  Bit Score: 507.62  E-value: 2.71e-174
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747  40 YRWNRVNYSRTRRVIDIWGFFLLILFYRWWDSKKWTYRSGDSEENRSRRQRMRAIWTRETMLELGPTFIKVGQLFSTRAD 119
Cdd:COG0661   5 YAVSRLPRIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLASSEELREKRAERLRLALEELGPTFIKLGQILSTRPD 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 120 LFPKEYIEELSRLQDEVPAFPYEQVVEIVEDQFGKPIPQVFQFFDPTPIAAASLGQVHRAQLHSGEDVVVKVQRPGLEKL 199
Cdd:COG0661  85 LVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRER 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 200 FNVDLGILRGIAQYLQNHPRYGRGgREWVPIYDECARILMQEIDYLNEGRNADTFRRNFKDSPEICVPRVYWRYSSPRVL 279
Cdd:COG0661 165 IEADLKLLRRLARLIKRLPPGGRR-LDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRVL 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 280 TLEYLPGIKISNYEALEAAGLDRRSLARIGARSYLQQLLNDGFFHADPHPGNIAVRHDGALIFYDFGMMGHIQPGTKEKL 359
Cdd:COG0661 244 TMEWIDGIKISDIAALKSAGIDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRSDGRIVLLDFGIVGRLDPKFRRYL 323
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 360 MDTFLGVAQSDADKVIDSLIELGAIKKSADRVPIRRSIEFLLTNFVNQPynLQSFNFAELTDDIYEMAYEQPFRFPATFT 439
Cdd:COG0661 324 AELLLAFLNRDYDRVAELHVELGYVPPDTDRDPLAAAIRAVLEPIYGKP--LEEISFGEILDKLFEVARRFPMRLPPELV 401
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 440 FVLRAVSTLEGLGKGLDPDFNFMDVAQPFADQLMaVNSEFgmRELFNQLGQQVGQVSSMTVNLPRRIEQTLeraDRGELR 519
Cdd:COG0661 402 LLQRTLLLVEGVGRQLDPRFNLWAVAQPLLAKWL-KKQLS--PKLLRELKDEAVAVLNALPLLPRLLRDLL---DNDREE 475
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....*
gi 37523747 520 VRTKSIETERLLKRLNSAAiggiYSVLLAAFLICSVVLYTADHIL 564
Cdd:COG0661 476 LSLRSSEELALLLLKAVAR----LSIGSILLVVLAVTVLLIAILL 516
ubiB PRK04750
putative ubiquinone biosynthesis protein UbiB; Reviewed
97-580 4.90e-87

putative ubiquinone biosynthesis protein UbiB; Reviewed


Pssm-ID: 235310  Cd Length: 537  Bit Score: 282.56  E-value: 4.90e-87
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   97 RETMLELGPTFIKVGQLFSTRADLFPKEYIEELSRLQDEVPAFPYEQVVEIVEDQFGKPIPQVFQFFDPTPIAAASLGQV 176
Cdd:PRK04750  56 RLALEELGPIFVKFGQMLSTRRDLFPPDIADELALLQDRVPPFDGALARAIIEKALGGPVEEWFDDFDIKPLASASIAQV 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747  177 HRAQLHS-GEDVVVKVQRPGLEKLFNVDLGILRGIAQYLqnhPRYGRGGREWVP--IYDECARILMQEIDYLNEGRNADT 253
Cdd:PRK04750 136 HFARLKDnGREVVVKVLRPDILPVIDADLALMYRLARWV---ERLLPDGRRLKPreVVAEFEKTLHDELDLMREAANASQ 212
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747  254 FRRNFKDSPEICVPRVYWRYSSPRVLTLEYLPGIKISNYEALEAAGLDRRSLARIGARSYLQQLLNDGFFHADPHPGNIA 333
Cdd:PRK04750 213 LRRNFEDSDMLYVPEVYWDYCSETVMVMERMYGIPVSDVAALRAAGTDMKLLAERGVEVFFTQVFRDGFFHADMHPGNIF 292
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747  334 VRHDGAL----IFYDFGMMGHIQPGTKEKLMDTFLGVAQSDADKVIDSLIELGAikksadrVPIRRSIEFLLTNF--VNQ 407
Cdd:PRK04750 293 VSYDPPEnpryIALDFGIVGSLNKEDKRYLAENFLAFFNRDYRRVAELHVESGW-------VPPDTRVEELEFAIraVCE 365
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747  408 PY---NLQSFNFAELTDDIYEMAYE-----QPfrfpatfTFVLRAvSTL---EGLGKGLDPDFNFMDVAQPFADQLMavN 476
Cdd:PRK04750 366 PIfdkPLAEISFGHVLLRLFNTARRfnveiQP-------QLVLLQ-KTLlnvEGLGRQLDPQLDLWKTAKPFLERWM--K 435
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747  477 SEFGMRELFNQLGQQVGQVSSMTVNLPRRIEQTLERADRGELRV--RTKSIETERLLKRLNSAAIGgiysvLLAAFLICS 554
Cdd:PRK04750 436 EQVGPRALVRALKEEAPFWAEKLPELPRLVHDSLRQGKLLQHSVdlLAEQLRTNRLRQGQSRYLLG-----VGATLLLAG 510
                        490       500
                 ....*....|....*....|....*.
gi 37523747  555 VVLYTADHILEAIAAFGLAGLLSFAL 580
Cdd:PRK04750 511 TLLLLSRPELMPGAAGLVAWLVGWRR 536
ABC1 pfam03109
ABC1 family; This family includes ABC1 from yeast and AarF from Escherichia coli. These ...
151-270 7.54e-46

ABC1 family; This family includes ABC1 from yeast and AarF from Escherichia coli. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex and Escherichia coli AarF is required for ubiquinone production. It has been suggested that members of the ABC1 family are novel chaperonins. These proteins are unrelated to the ABC transporter proteins.


Pssm-ID: 111949  Cd Length: 117  Bit Score: 158.14  E-value: 7.54e-46
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   151 QFGKPIPQVFQFFDPTPIAAASLGQVHRAQLHSGEDVVVKVQRPGLEKLFNVDLGILRGIAQYLQNHPrygrGGREWVPI 230
Cdd:pfam03109   2 ELGAPVEEVFAEFDEEPIAAASIAQVHRAVLKDGEEVAVKVQRPGVKKRIRSDLKLLKFLAKILKKFF----PGFDLDWL 77
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 37523747   231 YDECARILMQEIDYLNEGRNADTFRRNFKDSPEICVPRVY 270
Cdd:pfam03109  78 VDEFRKSLPQELDFLREAANAEKFRENFADLPWVYVPKVY 117
APH_ChoK_like cd05120
Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK ...
264-346 2.33e-05

Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine.


Pssm-ID: 240159  Cd Length: 155  Bit Score: 43.55  E-value: 2.33e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 264 ICVPRVYWRY-SSPRVLTL-EYLPGIKISNYEALEAAGLdRRSLARIGARsyLQQLLNDGFFHADPHPGNIAVRHDGALI 341
Cdd:cd05120  53 LPVPKVLASGeSDGWSYLLmEWIEGETLDEVSEEEKEDI-AEQLAELLAK--LHQLPLLVLCHGDLHPGNILVDDGKILG 129

                ....*
gi 37523747 342 FYDFG 346
Cdd:cd05120 130 IIDWE 134
arch_bud32 TIGR03724
Kae1-associated kinase Bud32; Members of this protein family are the Bud32 protein associated ...
264-347 7.28e-03

Kae1-associated kinase Bud32; Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine [Unknown function, General].


Pssm-ID: 234331  Cd Length: 199  Bit Score: 36.81  E-value: 7.28e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   264 ICVPRVYWRYSSPRVLTLEYLPGIKISnyEALEAAGLDR-RSLARIGARsylqqLLNDGFFHADPHPGNIAVrHDGALIF 342
Cdd:TIGR03724  59 VNTPVVYDVDPDNKTIVMEYIEGKPLK--DVIEEGNDELlREIGRLVGK-----LHKAGIVHGDLTTSNIIV-RDDKLYL 130

                  ....*
gi 37523747   343 YDFGM 347
Cdd:TIGR03724 131 IDFGL 135
UbiB TIGR01982
2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the ...
84-484 3.34e-124

2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].


Pssm-ID: 233667 [Multi-domain]  Cd Length: 437  Bit Score: 376.25  E-value: 3.34e-124
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747    84 NRSRRQRMRAIWTRETMLELGPTFIKVGQLFSTRADLFPKEYIEELSRLQDEVPAFPYEQVVEIVEDQFGKPIPQVFQFF 163
Cdd:TIGR01982  41 NRENRLMSRGERLRLALEELGPTFIKFGQTLSTRADLLPADIAEELSLLQDRVPPFDFKVARKVIEAALGGPLEELFAEF 120
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   164 DPTPIAAASLGQVHRAQLHSGEDVVVKVQRPGLEKLFNVDLGILRGIAQYLQNHPRYGRGGREwVPIYDECARILMQEID 243
Cdd:TIGR01982 121 EEKPLAAASIAQVHRARLVDGKEVAVKVLRPGIEKTIAADIALLYRLARIVERLSPDSRRLRP-TEVVKEFEKTLRRELD 199
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   244 YLNEGRNADTFRRNFKDSPEICVPRVYWRYSSPRVLTLEYLPGIKISNYEALEAAGLDRRSLARIGARSYLQQLLNDGFF 323
Cdd:TIGR01982 200 LRREAANASELGENFKNDPGVYVPEVYWDRTSERVLTMEWIDGIPLSDIAALDEAGLDRKALAENLARSFLNQVLRDGFF 279
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   324 HADPHPGNIAVRHDGALIFYDFGMMGHIQPGTKEKLMDTFLGVAQSDADKVIDSLIELGAIKKSADRVPIRRSIEFLLTN 403
Cdd:TIGR01982 280 HADLHPGNIFVLKDGKIIALDFGIVGRLSEEDRRYLAEILYGFLNRDYRRVAEVHFDAGYVPSDTDMAEFEQAIRAIGEP 359
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   404 FVNQPynLQSFNFAELTDDIYEMAYEQPFRFPATFTFVLRAVSTLEGLGKGLDPDFNFMDVAQPFADQLMavNSEFGMRE 483
Cdd:TIGR01982 360 IFGQP--LKEISVGRLLAGLFKITRDFNMELQPQLLLLQKTLLTVEGVGRQLDPDLNMWKVAEPFVKRWI--RKRLGPKA 435

                  .
gi 37523747   484 L 484
Cdd:TIGR01982 436 K 436
 
Name Accession Description Interval E-value
AarF COG0661
Predicted unusual protein kinase [General function prediction only]
40-564 2.71e-174

Predicted unusual protein kinase [General function prediction only]


Pssm-ID: 223733  Cd Length: 517  Bit Score: 507.62  E-value: 2.71e-174
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747  40 YRWNRVNYSRTRRVIDIWGFFLLILFYRWWDSKKWTYRSGDSEENRSRRQRMRAIWTRETMLELGPTFIKVGQLFSTRAD 119
Cdd:COG0661   5 YAVSRLPRIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLASSEELREKRAERLRLALEELGPTFIKLGQILSTRPD 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 120 LFPKEYIEELSRLQDEVPAFPYEQVVEIVEDQFGKPIPQVFQFFDPTPIAAASLGQVHRAQLHSGEDVVVKVQRPGLEKL 199
Cdd:COG0661  85 LVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRER 164
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 200 FNVDLGILRGIAQYLQNHPRYGRGgREWVPIYDECARILMQEIDYLNEGRNADTFRRNFKDSPEICVPRVYWRYSSPRVL 279
Cdd:COG0661 165 IEADLKLLRRLARLIKRLPPGGRR-LDLVEVVDEFEKRLREELDYRREAANAERFRENFKDDPDVYVPKVYWEYTTRRVL 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 280 TLEYLPGIKISNYEALEAAGLDRRSLARIGARSYLQQLLNDGFFHADPHPGNIAVRHDGALIFYDFGMMGHIQPGTKEKL 359
Cdd:COG0661 244 TMEWIDGIKISDIAALKSAGIDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRSDGRIVLLDFGIVGRLDPKFRRYL 323
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 360 MDTFLGVAQSDADKVIDSLIELGAIKKSADRVPIRRSIEFLLTNFVNQPynLQSFNFAELTDDIYEMAYEQPFRFPATFT 439
Cdd:COG0661 324 AELLLAFLNRDYDRVAELHVELGYVPPDTDRDPLAAAIRAVLEPIYGKP--LEEISFGEILDKLFEVARRFPMRLPPELV 401
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 440 FVLRAVSTLEGLGKGLDPDFNFMDVAQPFADQLMaVNSEFgmRELFNQLGQQVGQVSSMTVNLPRRIEQTLeraDRGELR 519
Cdd:COG0661 402 LLQRTLLLVEGVGRQLDPRFNLWAVAQPLLAKWL-KKQLS--PKLLRELKDEAVAVLNALPLLPRLLRDLL---DNDREE 475
                       490       500       510       520
                ....*....|....*....|....*....|....*....|....*
gi 37523747 520 VRTKSIETERLLKRLNSAAiggiYSVLLAAFLICSVVLYTADHIL 564
Cdd:COG0661 476 LSLRSSEELALLLLKAVAR----LSIGSILLVVLAVTVLLIAILL 516
ubiB PRK04750
putative ubiquinone biosynthesis protein UbiB; Reviewed
97-580 4.90e-87

putative ubiquinone biosynthesis protein UbiB; Reviewed


Pssm-ID: 235310  Cd Length: 537  Bit Score: 282.56  E-value: 4.90e-87
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   97 RETMLELGPTFIKVGQLFSTRADLFPKEYIEELSRLQDEVPAFPYEQVVEIVEDQFGKPIPQVFQFFDPTPIAAASLGQV 176
Cdd:PRK04750  56 RLALEELGPIFVKFGQMLSTRRDLFPPDIADELALLQDRVPPFDGALARAIIEKALGGPVEEWFDDFDIKPLASASIAQV 135
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747  177 HRAQLHS-GEDVVVKVQRPGLEKLFNVDLGILRGIAQYLqnhPRYGRGGREWVP--IYDECARILMQEIDYLNEGRNADT 253
Cdd:PRK04750 136 HFARLKDnGREVVVKVLRPDILPVIDADLALMYRLARWV---ERLLPDGRRLKPreVVAEFEKTLHDELDLMREAANASQ 212
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747  254 FRRNFKDSPEICVPRVYWRYSSPRVLTLEYLPGIKISNYEALEAAGLDRRSLARIGARSYLQQLLNDGFFHADPHPGNIA 333
Cdd:PRK04750 213 LRRNFEDSDMLYVPEVYWDYCSETVMVMERMYGIPVSDVAALRAAGTDMKLLAERGVEVFFTQVFRDGFFHADMHPGNIF 292
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747  334 VRHDGAL----IFYDFGMMGHIQPGTKEKLMDTFLGVAQSDADKVIDSLIELGAikksadrVPIRRSIEFLLTNF--VNQ 407
Cdd:PRK04750 293 VSYDPPEnpryIALDFGIVGSLNKEDKRYLAENFLAFFNRDYRRVAELHVESGW-------VPPDTRVEELEFAIraVCE 365
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747  408 PY---NLQSFNFAELTDDIYEMAYE-----QPfrfpatfTFVLRAvSTL---EGLGKGLDPDFNFMDVAQPFADQLMavN 476
Cdd:PRK04750 366 PIfdkPLAEISFGHVLLRLFNTARRfnveiQP-------QLVLLQ-KTLlnvEGLGRQLDPQLDLWKTAKPFLERWM--K 435
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747  477 SEFGMRELFNQLGQQVGQVSSMTVNLPRRIEQTLERADRGELRV--RTKSIETERLLKRLNSAAIGgiysvLLAAFLICS 554
Cdd:PRK04750 436 EQVGPRALVRALKEEAPFWAEKLPELPRLVHDSLRQGKLLQHSVdlLAEQLRTNRLRQGQSRYLLG-----VGATLLLAG 510
                        490       500
                 ....*....|....*....|....*.
gi 37523747  555 VVLYTADHILEAIAAFGLAGLLSFAL 580
Cdd:PRK04750 511 TLLLLSRPELMPGAAGLVAWLVGWRR 536
ABC1 pfam03109
ABC1 family; This family includes ABC1 from yeast and AarF from Escherichia coli. These ...
151-270 7.54e-46

ABC1 family; This family includes ABC1 from yeast and AarF from Escherichia coli. These proteins have a nuclear or mitochondrial subcellular location in eukaryotes. The exact molecular functions of these proteins is not clear, however yeast ABC1 suppresses a cytochrome b mRNA translation defect and is essential for the electron transfer in the bc 1 complex and Escherichia coli AarF is required for ubiquinone production. It has been suggested that members of the ABC1 family are novel chaperonins. These proteins are unrelated to the ABC transporter proteins.


Pssm-ID: 111949  Cd Length: 117  Bit Score: 158.14  E-value: 7.54e-46
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   151 QFGKPIPQVFQFFDPTPIAAASLGQVHRAQLHSGEDVVVKVQRPGLEKLFNVDLGILRGIAQYLQNHPrygrGGREWVPI 230
Cdd:pfam03109   2 ELGAPVEEVFAEFDEEPIAAASIAQVHRAVLKDGEEVAVKVQRPGVKKRIRSDLKLLKFLAKILKKFF----PGFDLDWL 77
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 37523747   231 YDECARILMQEIDYLNEGRNADTFRRNFKDSPEICVPRVY 270
Cdd:pfam03109  78 VDEFRKSLPQELDFLREAANAEKFRENFADLPWVYVPKVY 117
APH_ChoK_like cd05120
Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK ...
264-346 2.33e-05

Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves as precursors to the synthesis of important biological compounds, such as the major phospholipids, phosphatidylcholine and phosphatidylethanolamine and the amino acids, threonine, methionine, and isoleucine.


Pssm-ID: 240159  Cd Length: 155  Bit Score: 43.55  E-value: 2.33e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 264 ICVPRVYWRY-SSPRVLTL-EYLPGIKISNYEALEAAGLdRRSLARIGARsyLQQLLNDGFFHADPHPGNIAVRHDGALI 341
Cdd:cd05120  53 LPVPKVLASGeSDGWSYLLmEWIEGETLDEVSEEEKEDI-AEQLAELLAK--LHQLPLLVLCHGDLHPGNILVDDGKILG 129

                ....*
gi 37523747 342 FYDFG 346
Cdd:cd05120 130 IIDWE 134
COG3642 COG3642
Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]
264-347 1.46e-03

Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]


Pssm-ID: 226168  Cd Length: 204  Bit Score: 38.80  E-value: 1.46e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 264 ICVPRVYWRYSSPRVLTLEYLPGIKISNYeaLEAAGLDRrsLARIGarSYLQQLLNDGFFHADPHPGNIAVRhDGALIFY 343
Cdd:COG3642  61 VPVPIVYDVDPDNGLIVMEYIEGELLKDA--LEEARPDL--LREVG--RLVGKLHKAGIVHGDLTTSNIILS-GGRIYFI 133

                ....
gi 37523747 344 DFGM 347
Cdd:COG3642 134 DFGL 137
PI4Kc_III_beta cd05168
Phosphoinositide 4-kinase (PI4K), Type III, beta isoform, catalytic domain; The PI4K catalytic ...
303-391 7.16e-03

Phosphoinositide 4-kinase (PI4K), Type III, beta isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes. PI4KIIIbeta (also called Pik1p in yeast) is a 110 kDa protein that is localized to the Golgi and the nucleus. It is required for maintaining the structural integrity of the Golgi complex (GC), and is a key regulator of protein transport from the GC to the plasma membrane. PI4KIIIbeta also functions in the genesis, transport, and exocytosis of synaptic vesicles. The Drosophila PI4KIIIbeta is essential for cytokinesis during spermatogenesis.


Pssm-ID: 119428 [Multi-domain]  Cd Length: 293  Bit Score: 37.17  E-value: 7.16e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747 303 RSLARIGARSYLQQLlndgffhADPHPGNIAVRHDGALIFYDFGMMGHIQPG-----------TKE--KLMDtflGVaQS 369
Cdd:cd05168 131 ESLAGYSLICYLLQI-------KDRHNGNILIDNDGHIIHIDFGFMLSNSPGnvgfetapfklTQEyiEVMG---GV-NS 199
                        90       100
                ....*....|....*....|....
gi 37523747 370 DADKVIDSLIELG--AIKKSADRV 391
Cdd:cd05168 200 DLFNYFKKLFLKGfmALRKHVDRI 223
arch_bud32 TIGR03724
Kae1-associated kinase Bud32; Members of this protein family are the Bud32 protein associated ...
264-347 7.28e-03

Kae1-associated kinase Bud32; Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine [Unknown function, General].


Pssm-ID: 234331  Cd Length: 199  Bit Score: 36.81  E-value: 7.28e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   264 ICVPRVYWRYSSPRVLTLEYLPGIKISnyEALEAAGLDR-RSLARIGARsylqqLLNDGFFHADPHPGNIAVrHDGALIF 342
Cdd:TIGR03724  59 VNTPVVYDVDPDNKTIVMEYIEGKPLK--DVIEEGNDELlREIGRLVGK-----LHKAGIVHGDLTTSNIIV-RDDKLYL 130

                  ....*
gi 37523747   343 YDFGM 347
Cdd:TIGR03724 131 IDFGL 135
UbiB TIGR01982
2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the ...
84-484 3.34e-124

2-polyprenylphenol 6-hydroxylase; This model represents the enzyme (UbiB) which catalyzes the first hydroxylation step in the ubiquinone biosynthetic pathway in bacteria. It is believed that the reaction is 2-polyprenylphenol -> 6-hydroxy-2-polyprenylphenol. This model finds hits primarily in the proteobacteria. The gene is also known as AarF in certain species [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone].


Pssm-ID: 233667 [Multi-domain]  Cd Length: 437  Bit Score: 376.25  E-value: 3.34e-124
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747    84 NRSRRQRMRAIWTRETMLELGPTFIKVGQLFSTRADLFPKEYIEELSRLQDEVPAFPYEQVVEIVEDQFGKPIPQVFQFF 163
Cdd:TIGR01982  41 NRENRLMSRGERLRLALEELGPTFIKFGQTLSTRADLLPADIAEELSLLQDRVPPFDFKVARKVIEAALGGPLEELFAEF 120
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   164 DPTPIAAASLGQVHRAQLHSGEDVVVKVQRPGLEKLFNVDLGILRGIAQYLQNHPRYGRGGREwVPIYDECARILMQEID 243
Cdd:TIGR01982 121 EEKPLAAASIAQVHRARLVDGKEVAVKVLRPGIEKTIAADIALLYRLARIVERLSPDSRRLRP-TEVVKEFEKTLRRELD 199
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   244 YLNEGRNADTFRRNFKDSPEICVPRVYWRYSSPRVLTLEYLPGIKISNYEALEAAGLDRRSLARIGARSYLQQLLNDGFF 323
Cdd:TIGR01982 200 LRREAANASELGENFKNDPGVYVPEVYWDRTSERVLTMEWIDGIPLSDIAALDEAGLDRKALAENLARSFLNQVLRDGFF 279
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   324 HADPHPGNIAVRHDGALIFYDFGMMGHIQPGTKEKLMDTFLGVAQSDADKVIDSLIELGAIKKSADRVPIRRSIEFLLTN 403
Cdd:TIGR01982 280 HADLHPGNIFVLKDGKIIALDFGIVGRLSEEDRRYLAEILYGFLNRDYRRVAEVHFDAGYVPSDTDMAEFEQAIRAIGEP 359
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37523747   404 FVNQPynLQSFNFAELTDDIYEMAYEQPFRFPATFTFVLRAVSTLEGLGKGLDPDFNFMDVAQPFADQLMavNSEFGMRE 483
Cdd:TIGR01982 360 IFGQP--LKEISVGRLLAGLFKITRDFNMELQPQLLLLQKTLLTVEGVGRQLDPDLNMWKVAEPFVKRWI--RKRLGPKA 435

                  .
gi 37523747   484 L 484
Cdd:TIGR01982 436 K 436
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH