NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|350592247|ref|XP_003483426.1|]
View 

PREDICTED: serine palmitoyltransferase 1 [Sus scrofa]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
AAT_I super family cl18945
Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP) ...
11-472 5.80e-165

Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the substrate in four kinds of reactions (1) transamination (movement of amino groups), (2) racemization (redistribution of enantiomers), (3) decarboxylation (removing COOH groups), and (4) various side-chain reactions depending on the enzyme involved. Pyridoxal phosphate (PLP) dependent enzymes were previously classified into alpha, beta and gamma classes, based on the chemical characteristics (carbon atom involved) of the reaction they catalyzed. The availability of several structures allowed a comprehensive analysis of the evolutionary classification of PLP dependent enzymes, and it was found that the functional classification did not always agree with the evolutionary history of these enzymes. Structure and sequence analysis has revealed that the PLP dependent enzymes can be classified into four major groups of different evolutionary origin: aspartate aminotransferase superfamily (fold type I), tryptophan synthase beta superfamily (fold type II), alanine racemase superfamily (fold type III), and D-amino acid superfamily (fold type IV) and Glycogen phophorylase family (fold type V).


The actual alignment was detected with superfamily member PLN02822:

Pssm-ID: 277505  Cd Length: 481  Bit Score: 477.70  E-value: 5.80e-165
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  11 VEMVQALYEAPAY-----------HLILEGILILWIIRLLFSKTYKLQERSdLTVKEKEELIEEWQPEPLVPPVSK---- 75
Cdd:PLN02822  13 LERVTMLLEAPLAravvfgvhiggHLVVEGLLIVVIVFLLSQKSYKPPKRP-LTEKEIDELCDEWTPEPLIPPITEemrp 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  76 DHPALNYniVSGPpshNIVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKF 155
Cdd:PLN02822  92 EPPVLES--AAGP---HTIINGKDVVNFASANYLGLIGNEKIKESCTSALEKYGVGSCGPRGFYGTIDVHLDCETKIAKF 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 156 MKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQEIEDqknpRKA 235
Cdd:PLN02822 167 LGTPDSILYSYGLSTIFSVIPAFCKKGDIIVADEGVHWGIQNGLYLSRSTIVYFKHNDMESLRNTLEKLTAEN----KRK 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 236 RVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLISANMENSLASIG 315
Cdd:PLN02822 243 KKLRRYIVVEAIYQNSGQIAPLDEIVRLKEKYRFRVLLDESNSFGVLGKSGRGLSEHFGVPIEKIDIITAAMGHALATEG 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 316 GFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQGISGLKVAGESISPAFH 395
Cdd:PLN02822 323 GFCTGSARVVDHQRLSSSGYVFSASLPPYLASAAITAIDVLEDNPSVLAKLKENIALLHKGLSDIPGLSIGSNTLSPIVF 402
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 396 LQLEESTGSRDKDVKLLQEIVTGCMDRG---IALTQARYLEKEEknlPPPSIRVVVTVEQTEEELDKAASTINEVAQIVL 472
Cdd:PLN02822 403 LHLEKSTGSAKEDLSLLEHIADRMLKEDsvlVVVSKRSTLDKCR---LPVGIRLFVSAGHTESDILKASESLKRVAASVL 479
BioF COG0156
7-keto-8-aminopelargonate synthetase or related enzyme [Coenzyme transport and metabolism]; ...
81-467 1.16e-96

7-keto-8-aminopelargonate synthetase or related enzyme [Coenzyme transport and metabolism]; linked to 3D-structure


:

Pssm-ID: 223234 [Multi-domain]  Cd Length: 388  Bit Score: 299.17  E-value: 1.16e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  81 NYNIVSGPPSHNIVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEE 160
Cdd:COG0156   22 GLRALDRRQGLAIRADGRKVLNFCSNDYLGLASHPELIEAAKAAIRRYGVGAGGSRLISGTSDLHVELEEELADFLGAEA 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 161 AIIYSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEqeiedqknPRKARVTRR 240
Cdd:COG0156  102 ALLFSSGFVANLGLLSALLKKGDLIFSDELNHASIIDGIRLSRAEVRRFKHNDLDHLEALLEE--------ARENGARRK 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 241 FIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLISANMENSLASIGGFCCG 320
Cdd:COG0156  174 LIVTEGVFSMDGDIAPLPELVELAEKYGALLYVDEAHAVGVLGPNGRGLAEHFGLEPEEVDIIVGTLGKALGSSGGYIAG 253
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 321 RSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQgISGLKVAGeSISPAFHLQLee 400
Cdd:COG0156  254 SAALIDYLRNRARPFIFSTALPPAVAAAALAALRILEEGPERRERLQELAAFFRSLLK-ALGLVLLP-SESPIIPVIL-- 329
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 350592247 401 stgsrdKDVKLLQEIVTGCMDRGIALTQARY--LEKEEknlppPSIRVVVTVEQTEEELDKAASTINEV 467
Cdd:COG0156  330 ------GDEERALEASRALLEEGIYVSAIRPptVPKGT-----ARLRITLTAAHTEEDIDRLAEALSEV 387
 
Name Accession Description Interval E-value
PLN02822 PLN02822
serine palmitoyltransferase
11-472 5.80e-165

serine palmitoyltransferase


Pssm-ID: 178417  Cd Length: 481  Bit Score: 477.70  E-value: 5.80e-165
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  11 VEMVQALYEAPAY-----------HLILEGILILWIIRLLFSKTYKLQERSdLTVKEKEELIEEWQPEPLVPPVSK---- 75
Cdd:PLN02822  13 LERVTMLLEAPLAravvfgvhiggHLVVEGLLIVVIVFLLSQKSYKPPKRP-LTEKEIDELCDEWTPEPLIPPITEemrp 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  76 DHPALNYniVSGPpshNIVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKF 155
Cdd:PLN02822  92 EPPVLES--AAGP---HTIINGKDVVNFASANYLGLIGNEKIKESCTSALEKYGVGSCGPRGFYGTIDVHLDCETKIAKF 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 156 MKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQEIEDqknpRKA 235
Cdd:PLN02822 167 LGTPDSILYSYGLSTIFSVIPAFCKKGDIIVADEGVHWGIQNGLYLSRSTIVYFKHNDMESLRNTLEKLTAEN----KRK 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 236 RVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLISANMENSLASIG 315
Cdd:PLN02822 243 KKLRRYIVVEAIYQNSGQIAPLDEIVRLKEKYRFRVLLDESNSFGVLGKSGRGLSEHFGVPIEKIDIITAAMGHALATEG 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 316 GFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQGISGLKVAGESISPAFH 395
Cdd:PLN02822 323 GFCTGSARVVDHQRLSSSGYVFSASLPPYLASAAITAIDVLEDNPSVLAKLKENIALLHKGLSDIPGLSIGSNTLSPIVF 402
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 396 LQLEESTGSRDKDVKLLQEIVTGCMDRG---IALTQARYLEKEEknlPPPSIRVVVTVEQTEEELDKAASTINEVAQIVL 472
Cdd:PLN02822 403 LHLEKSTGSAKEDLSLLEHIADRMLKEDsvlVVVSKRSTLDKCR---LPVGIRLFVSAGHTESDILKASESLKRVAASVL 479
KBL_like cd06454
KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate ...
98-467 9.07e-76

KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD corresponds to serine palmitoyltransferase (SPT), 5-aminolevulinate synthase (ALAS), 8-amino-7-oxononanoate synthase (AONS), and 2-amino-3-ketobutyrate CoA ligase (KBL). SPT is responsible for the condensation of L-serine with palmitoyl-CoA to produce 3-ketodihydrospingosine, the reaction of the first step in sphingolipid biosynthesis. ALAS is involved in heme biosynthesis; it catalyzes the synthesis of 5-aminolevulinic acid from glycine and succinyl-coenzyme A. AONS catalyses the decarboxylative condensation of l-alanine and pimeloyl-CoA in the first committed step of biotin biosynthesis. KBL catalyzes the second reaction step of the metabolic degradation pathway for threonine converting 2-amino-3-ketobutyrate, to glycine and acetyl-CoA. The members of this CD are widely found in all three forms of life.


Pssm-ID: 99747  Cd Length: 349  Bit Score: 243.62  E-value: 9.07e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  98 KECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPA 177
Cdd:cd06454    1 KKVLNFCSNDYLGLANHPEVIEAAKEALDKYGVGAGGSRLISGTSDLHEELEEELAEFHGKEAALVFSSGYAANDGVLST 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 178 YSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEqeiedqkNPRKARvtRRFIVVEGLYMNTGTICPL 257
Cdd:cd06454   81 LAGKGDLIISDSLNHASIIDGIRLSGAKKRIFKHNDMEDLEKLLRE-------ARRPYG--KKLIVTEGVYSMDGDIAPL 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 258 PELVKLKYKYKARIFLEESLSFGVLGEHGRGVtEHFGINIDDIDLISANMENSLASIGGFCCGRSFVIDHQRLSGQGYCF 337
Cdd:cd06454  152 PELVDLAKKYGAILFVDEAHSVGVYGPHGRGV-EEFGGLTDDVDIIMGTLGKAFGAVGGYIAGSKELIDYLRSYARGFIF 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 338 SASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQGIsGLKVAGESISPAFHLQLEEStgsrdkdvKLLQEIVT 417
Cdd:cd06454  231 STSLPPAVAAAALAALEVLQGGPERRERLQENVRYLRRGLKEL-GFPVGGSPSHIIPPLIGDDP--------AKAVAFSD 301
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
gi 350592247 418 GCMDRGIALTQARY---LEKEEKnlpppsIRVVVTVEQTEEELDKAASTINEV 467
Cdd:cd06454  302 ALLERGIYVQAIRYptvPRGTAR------LRISLSAAHTKEDIDRLLEALKEV 348
gly_Cac_T_rel TIGR01825
pyridoxal phosphate-dependent acyltransferase, putative; This model represents an enzyme ...
84-469 1.06e-60

pyridoxal phosphate-dependent acyltransferase, putative; This model represents an enzyme subfamily related to three known enzymes; it appears closest to glycine C-acteyltransferase, shows no overlap with it in species distribution, and may share that function. The three closely related enzymes are glycine C-acetyltransferase (2-amino-3-ketobutyrate coenzyme A ligase), 5-aminolevulinic acid synthase, and 8-amino-7-oxononanoate synthase. All transfer the R-group (acetyl, succinyl, or 6-carboxyhexanoyl) from coenzyme A to an amino acid (Gly, Gly, Ala, respectively), with release of CO2 for the latter two reactions.


Pssm-ID: 130884  Cd Length: 385  Bit Score: 205.05  E-value: 1.06e-60
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247   84 IVSGPPSHNIVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAII 163
Cdd:TIGR01825  19 VLESAQGPRVRVNGKEVINLSSNNYLGFADHPRLKEAAAQAIQQYGVGAGAVRTIAGTLRLHEELEEKLAKFKKTEAALV 98
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  164 YSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEqeiedQKNPRKarvtrRFIV 243
Cdd:TIGR01825  99 FQSGFNTNQGVLSALLRKGDIVLSDELNHASIIDGLRLTKATKKIYKHADMDDLDRVLRE-----NPSYGK-----KLIV 168
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  244 VEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGINiDDIDLISANMENSLASIGGFCCGRSF 323
Cdd:TIGR01825 169 TDGVFSMDGDVAPLPEIVELAERYGAVTYVDDAHGSGVMGEAGRGTVHHFGLE-DKVDIQVGTLSKAIGVVGGYAAGHKE 247
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  324 VIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQGIsGLKVaGESISPAFHLQLEESTG 403
Cdd:TIGR01825 248 LIEYLKNRARPFLFSTAQPPAVVAALAAAVDELQRSPELMERLWDNTRFFKAGLGKL-GYDT-GGSETPITPVVIGDEKA 325
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 350592247  404 SRDKDVKLLQEivtGCMDRGIAL-TQARYLEKeeknlpppsIRVVVTVEQTEEELDKAASTINEVAQ 469
Cdd:TIGR01825 326 AQEFSRRLFDE---GIFAQSIVFpTVPRGTAR---------IRNIPTAEHTKDDLDQALDAYEKVGK 380
PRK06939 PRK06939
2-amino-3-ketobutyrate coenzyme A ligase; Provisional
84-460 1.82e-48

2-amino-3-ketobutyrate coenzyme A ligase; Provisional


Pssm-ID: 235893  Cd Length: 397  Bit Score: 172.30  E-value: 1.82e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  84 IVSGPPSHNI-VVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAI 162
Cdd:PRK06939  27 VITSPQGADItVADGKEVINFCANNYLGLANHPELIAAAKAALDSHGFGMASVRFICGTQDLHKELEEKLAKFLGTEDAI 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 163 IYSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQeiedqknpRKARVTRRFI 242
Cdd:PRK06939 107 LYSSCFDANGGLFETLLGKEDAIISDALNHASIIDGVRLCKAKRYRYANNDMADLEAQLKEA--------KEAGARHKLI 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 243 VVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGInIDDIDLISANMENSLA-SIGGFCCGR 321
Cdd:PRK06939 179 ATDGVFSMDGDIAPLPEICDLADKYDALVMVDDSHAVGFVGENGRGTVEHFGV-MDRVDIITGTLGKALGgASGGYTAGR 257
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 322 SFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKalqgisGLKVAGESISPAFHLQLEES 401
Cdd:PRK06939 258 KEVIDWLRQRSRPYLFSNSLAPAIVAASIKVLELLEESDELRDRLWENARYFRE------GMTAAGFTLGPGEHPIIPVM 331
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 350592247 402 TGsrdkDVKLLQEIVTGCMDRGIALT----------QARylekeeknlpppsIRVVVTVEQTEEELDKA 460
Cdd:PRK06939 332 LG----DAKLAQEFADRLLEEGVYVIgfsfpvvpkgQAR-------------IRTQMSAAHTKEQLDRA 383
BioF COG0156
7-keto-8-aminopelargonate synthetase or related enzyme [Coenzyme transport and metabolism]; ...
81-467 1.16e-96

7-keto-8-aminopelargonate synthetase or related enzyme [Coenzyme transport and metabolism]; linked to 3D-structure


Pssm-ID: 223234 [Multi-domain]  Cd Length: 388  Bit Score: 299.17  E-value: 1.16e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  81 NYNIVSGPPSHNIVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEE 160
Cdd:COG0156   22 GLRALDRRQGLAIRADGRKVLNFCSNDYLGLASHPELIEAAKAAIRRYGVGAGGSRLISGTSDLHVELEEELADFLGAEA 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 161 AIIYSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEqeiedqknPRKARVTRR 240
Cdd:COG0156  102 ALLFSSGFVANLGLLSALLKKGDLIFSDELNHASIIDGIRLSRAEVRRFKHNDLDHLEALLEE--------ARENGARRK 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 241 FIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLISANMENSLASIGGFCCG 320
Cdd:COG0156  174 LIVTEGVFSMDGDIAPLPELVELAEKYGALLYVDEAHAVGVLGPNGRGLAEHFGLEPEEVDIIVGTLGKALGSSGGYIAG 253
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 321 RSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQgISGLKVAGeSISPAFHLQLee 400
Cdd:COG0156  254 SAALIDYLRNRARPFIFSTALPPAVAAAALAALRILEEGPERRERLQELAAFFRSLLK-ALGLVLLP-SESPIIPVIL-- 329
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 350592247 401 stgsrdKDVKLLQEIVTGCMDRGIALTQARY--LEKEEknlppPSIRVVVTVEQTEEELDKAASTINEV 467
Cdd:COG0156  330 ------GDEERALEASRALLEEGIYVSAIRPptVPKGT-----ARLRITLTAAHTEEDIDRLAEALSEV 387
bioF TIGR00858
8-amino-7-oxononanoate synthase; 7-keto-8-aminopelargonic acid synthetase is an alternate name. ...
84-464 5.10e-61

8-amino-7-oxononanoate synthase; 7-keto-8-aminopelargonic acid synthetase is an alternate name. This model represents 8-amino-7-oxononanoate synthase, the BioF protein of biotin biosynthesis. This model is based on a careful phylogenetic analysis to separate members of this family from 2-amino-3-ketobutyrate and other related pyridoxal phosphate-dependent enzymes. In several species, including Staphylococcus and Coxiella, a candidate 8-amino-7-oxononanoate synthase is confirmed by location in the midst of a biotin biosynthesis operon but scores below the trusted cutoff of this model. [Biosynthesis of cofactors, prosthetic groups, and carriers, Biotin]


Pssm-ID: 273303 [Multi-domain]  Cd Length: 360  Bit Score: 205.19  E-value: 5.10e-61
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247   84 IVSGPPSHNIVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAII 163
Cdd:TIGR00858   2 PLDRGPGPEVVRDGRRLLNFSSNDYLGLASHPEVIQAAQQGAEQYGAGSTASRLVSGNSPLHEELEEELAEWKGTEAALL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  164 YSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQEIEDQKnprkarvtrrFIV 243
Cdd:TIGR00858  82 FSSGYLANVGVISALVGKGDLILSDALNHASLIDGCRLSGARVRRYRHNDVEHLERLLEKNRGERRK----------LIV 151
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  244 VEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLISANMENSLASIGGFCCGRSF 323
Cdd:TIGR00858 152 TDGVFSMDGDIAPLPQLVALAERYGAWLMVDDAHGTGVLGEDGRGTLEHFGLKPEPVDIQVGTLSKALGSYGAYVAGSQA 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  324 VIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQGISGLKVAGES-ISPAFhlqleesT 402
Cdd:TIGR00858 232 LIDYLINRARTLIFSTALPPAVAAAALAALELIQEEPWRREKLLALIARLRAGLEALGFTLMPSCTpIVPVI-------I 304
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 350592247  403 GSRDKDVkllqEIVTGCMDRGIALTQARylekeeknlpPPS-------IRVVVTVEQTEEELDKAASTI 464
Cdd:TIGR00858 305 GDNASAL----ALAEELQQQGIFVGAIR----------PPTvpagtsrLRLTLSAAHTPGDIDRLAEAL 359
Aminotran_1_2 pfam00155
Aminotransferase class I and II;
98-464 5.08e-25

Aminotransferase class I and II;


Pssm-ID: 249636 [Multi-domain]  Cd Length: 351  Bit Score: 104.31  E-value: 5.08e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247   98 KECINFASFNFLGLLdnprVKAAALASLKkygVGTCGPRGFYGTFDVHLDLEDRLAKFM--------KTEEAIIYSYGFA 169
Cdd:pfam00155   1 TDKINLGSNEYLGDT----LPAVAKAEKD---ALAGGTRNLYGPTDGLPELREALAKFLgrspvlklDREAAVVFGSGAG 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  170 TIASAIPAYSK-RGDIVFVDKAACFAIQKGLQASRSDIKLFE-------HNDMEDLERLLKEQeiedqknprkarvtRRF 241
Cdd:pfam00155  74 ANIEALIFLLAnPGDAILVPAPTYASYIRIARLAGGEVVRYPlydsndfHLDFDALEAALKEK--------------PKV 139
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  242 IVVEGLYMNTGTICPLPELVKL---KYKYKARIFLEESLSFGVLGEHGRGVTEHFGIniDDIDLISAN-MENSLASIG-- 315
Cdd:pfam00155 140 VLHTSPHNPTGTVATLEELEKLldlAKEHNILLLVDEAYAGFVFGSPDAVATRALLA--EGPNLLVVGsFSKAFGLAGwr 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  316 -GFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQGIsGLKVAGeSISPAF 394
Cdd:pfam00155 218 vGYILGNAAVISQLRKLARPFYSSTHLQAAAAAALSDPLLVASELEEMRQRIKERRDYLRDGLEAA-GLSVLP-SQAGFF 295
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  395 HLQLeestGSRDKDVKLLQEIVTgcmDRGIALTQARYLEKeeknlpPPSIRVVVTVeQTEEELDKAASTI 464
Cdd:pfam00155 296 LLTG----LDPETAKELAQVLLE---EVGVYVTPGSSPGV------PGWLRITVAG-GTEEELEELLEAI 351
 
Name Accession Description Interval E-value
PLN02822 PLN02822
serine palmitoyltransferase
11-472 5.80e-165

serine palmitoyltransferase


Pssm-ID: 178417  Cd Length: 481  Bit Score: 477.70  E-value: 5.80e-165
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  11 VEMVQALYEAPAY-----------HLILEGILILWIIRLLFSKTYKLQERSdLTVKEKEELIEEWQPEPLVPPVSK---- 75
Cdd:PLN02822  13 LERVTMLLEAPLAravvfgvhiggHLVVEGLLIVVIVFLLSQKSYKPPKRP-LTEKEIDELCDEWTPEPLIPPITEemrp 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  76 DHPALNYniVSGPpshNIVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKF 155
Cdd:PLN02822  92 EPPVLES--AAGP---HTIINGKDVVNFASANYLGLIGNEKIKESCTSALEKYGVGSCGPRGFYGTIDVHLDCETKIAKF 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 156 MKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQEIEDqknpRKA 235
Cdd:PLN02822 167 LGTPDSILYSYGLSTIFSVIPAFCKKGDIIVADEGVHWGIQNGLYLSRSTIVYFKHNDMESLRNTLEKLTAEN----KRK 242
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 236 RVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLISANMENSLASIG 315
Cdd:PLN02822 243 KKLRRYIVVEAIYQNSGQIAPLDEIVRLKEKYRFRVLLDESNSFGVLGKSGRGLSEHFGVPIEKIDIITAAMGHALATEG 322
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 316 GFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQGISGLKVAGESISPAFH 395
Cdd:PLN02822 323 GFCTGSARVVDHQRLSSSGYVFSASLPPYLASAAITAIDVLEDNPSVLAKLKENIALLHKGLSDIPGLSIGSNTLSPIVF 402
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 396 LQLEESTGSRDKDVKLLQEIVTGCMDRG---IALTQARYLEKEEknlPPPSIRVVVTVEQTEEELDKAASTINEVAQIVL 472
Cdd:PLN02822 403 LHLEKSTGSAKEDLSLLEHIADRMLKEDsvlVVVSKRSTLDKCR---LPVGIRLFVSAGHTESDILKASESLKRVAASVL 479
PLN03227 PLN03227
serine palmitoyltransferase-like protein; Provisional
101-472 1.58e-113

serine palmitoyltransferase-like protein; Provisional


Pssm-ID: 178766  Cd Length: 392  Bit Score: 343.04  E-value: 1.58e-113
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 101 INFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSK 180
Cdd:PLN03227   1 LNFATHDFLSTSSSPTLRQTALESLSHYGCGSCGPRGFYGTIDAHLELEQCMAEFLGTESAILYSDGASTTSSTVAAFAK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 181 RGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPEL 260
Cdd:PLN03227  81 RGDLLVVDRGVNEALLVGVSLSRANVRWFRHNDMKDLRRVLEQVRAQDVALKRKPTDQRRFLVVEGLYKNTGTLAPLKEL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 261 VKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGIN-IDDIDLISANMENSLASIGGFCCGRSFVIDHQRLSGQGYCFSA 339
Cdd:PLN03227 161 VALKEEFHYRLILDESFSFGTLGKSGRGSLEHAGLKpMVHAEIVTFSLENAFGSVGGMTVGSEEVVDHQRLSGSGYCFSA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 340 SLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQGIS---------GLKVAGESISPAFHLQLEESTGSRDKD-V 409
Cdd:PLN03227 241 SAPPFLAKADATATAGELAGPQLLNRLHDSIANLYSTLTNSShpyalklrnRLVITSDPISPIIYLRLSDQEATRRTDeT 320
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 350592247 410 KLLQEIVTGCMDRGIALTQAR-YLEKEEKNLPPPSIRVVVTVEQTEEELDKAASTINEVAQIVL 472
Cdd:PLN03227 321 LILDQIAHHSLSEGVAVVSTGgHVKKFLQLVPPPCLRVVANASHTREDIDKLLTVLGEAVEAIL 384
KBL_like cd06454
KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate ...
98-467 9.07e-76

KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD corresponds to serine palmitoyltransferase (SPT), 5-aminolevulinate synthase (ALAS), 8-amino-7-oxononanoate synthase (AONS), and 2-amino-3-ketobutyrate CoA ligase (KBL). SPT is responsible for the condensation of L-serine with palmitoyl-CoA to produce 3-ketodihydrospingosine, the reaction of the first step in sphingolipid biosynthesis. ALAS is involved in heme biosynthesis; it catalyzes the synthesis of 5-aminolevulinic acid from glycine and succinyl-coenzyme A. AONS catalyses the decarboxylative condensation of l-alanine and pimeloyl-CoA in the first committed step of biotin biosynthesis. KBL catalyzes the second reaction step of the metabolic degradation pathway for threonine converting 2-amino-3-ketobutyrate, to glycine and acetyl-CoA. The members of this CD are widely found in all three forms of life.


Pssm-ID: 99747  Cd Length: 349  Bit Score: 243.62  E-value: 9.07e-76
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  98 KECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPA 177
Cdd:cd06454    1 KKVLNFCSNDYLGLANHPEVIEAAKEALDKYGVGAGGSRLISGTSDLHEELEEELAEFHGKEAALVFSSGYAANDGVLST 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 178 YSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEqeiedqkNPRKARvtRRFIVVEGLYMNTGTICPL 257
Cdd:cd06454   81 LAGKGDLIISDSLNHASIIDGIRLSGAKKRIFKHNDMEDLEKLLRE-------ARRPYG--KKLIVTEGVYSMDGDIAPL 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 258 PELVKLKYKYKARIFLEESLSFGVLGEHGRGVtEHFGINIDDIDLISANMENSLASIGGFCCGRSFVIDHQRLSGQGYCF 337
Cdd:cd06454  152 PELVDLAKKYGAILFVDEAHSVGVYGPHGRGV-EEFGGLTDDVDIIMGTLGKAFGAVGGYIAGSKELIDYLRSYARGFIF 230
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 338 SASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQGIsGLKVAGESISPAFHLQLEEStgsrdkdvKLLQEIVT 417
Cdd:cd06454  231 STSLPPAVAAAALAALEVLQGGPERRERLQENVRYLRRGLKEL-GFPVGGSPSHIIPPLIGDDP--------AKAVAFSD 301
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
gi 350592247 418 GCMDRGIALTQARY---LEKEEKnlpppsIRVVVTVEQTEEELDKAASTINEV 467
Cdd:cd06454  302 ALLERGIYVQAIRYptvPRGTAR------LRISLSAAHTKEDIDRLLEALKEV 348
gly_Cac_T_rel TIGR01825
pyridoxal phosphate-dependent acyltransferase, putative; This model represents an enzyme ...
84-469 1.06e-60

pyridoxal phosphate-dependent acyltransferase, putative; This model represents an enzyme subfamily related to three known enzymes; it appears closest to glycine C-acteyltransferase, shows no overlap with it in species distribution, and may share that function. The three closely related enzymes are glycine C-acetyltransferase (2-amino-3-ketobutyrate coenzyme A ligase), 5-aminolevulinic acid synthase, and 8-amino-7-oxononanoate synthase. All transfer the R-group (acetyl, succinyl, or 6-carboxyhexanoyl) from coenzyme A to an amino acid (Gly, Gly, Ala, respectively), with release of CO2 for the latter two reactions.


Pssm-ID: 130884  Cd Length: 385  Bit Score: 205.05  E-value: 1.06e-60
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247   84 IVSGPPSHNIVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAII 163
Cdd:TIGR01825  19 VLESAQGPRVRVNGKEVINLSSNNYLGFADHPRLKEAAAQAIQQYGVGAGAVRTIAGTLRLHEELEEKLAKFKKTEAALV 98
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  164 YSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEqeiedQKNPRKarvtrRFIV 243
Cdd:TIGR01825  99 FQSGFNTNQGVLSALLRKGDIVLSDELNHASIIDGLRLTKATKKIYKHADMDDLDRVLRE-----NPSYGK-----KLIV 168
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  244 VEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGINiDDIDLISANMENSLASIGGFCCGRSF 323
Cdd:TIGR01825 169 TDGVFSMDGDVAPLPEIVELAERYGAVTYVDDAHGSGVMGEAGRGTVHHFGLE-DKVDIQVGTLSKAIGVVGGYAAGHKE 247
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  324 VIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQGIsGLKVaGESISPAFHLQLEESTG 403
Cdd:TIGR01825 248 LIEYLKNRARPFLFSTAQPPAVVAALAAAVDELQRSPELMERLWDNTRFFKAGLGKL-GYDT-GGSETPITPVVIGDEKA 325
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 350592247  404 SRDKDVKLLQEivtGCMDRGIAL-TQARYLEKeeknlpppsIRVVVTVEQTEEELDKAASTINEVAQ 469
Cdd:TIGR01825 326 AQEFSRRLFDE---GIFAQSIVFpTVPRGTAR---------IRNIPTAEHTKDDLDQALDAYEKVGK 380
PLN02483 PLN02483
serine palmitoyltransferase
96-471 2.17e-55

serine palmitoyltransferase


Pssm-ID: 178101  Cd Length: 489  Bit Score: 193.44  E-value: 2.17e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  96 NGKECINFASFNFLGLLD-----NPRVkaaaLASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFAT 170
Cdd:PLN02483  98 KTRRCLNLGSYNYLGFAAadeycTPRV----IESLKKYSASTCSSRVDGGTTKLHRELEELVARFVGKPAAIVFGMGYAT 173
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 171 IASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQEIEDQknPRKARVTRRFIV-VEGLYM 249
Cdd:PLN02483 174 NSTIIPALIGKGGLIISDSLNHNSIVNGARGSGATIRVFQHNTPSHLEEVLREQIAEGQ--PRTHRPWKKIIViVEGIYS 251
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 250 NTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLISANMENSLASIGGFCCGRSFVIDHQR 329
Cdd:PLN02483 252 MEGELCKLPEIVAVCKKYKAYVYLDEAHSIGAVGKTGRGVCELLGVDPADVDIMMGTFTKSFGSCGGYIAGSKELIQYLK 331
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 330 LSGQGYCFSASL-PPLLAAAAIEALNIMEE---NPGifavlKEKCKRIHK-------ALQGIsGLKVAGESISPAFHLQL 398
Cdd:PLN02483 332 RTCPAHLYATSMsPPAVQQVISAIKVILGEdgtNRG-----AQKLAQIREnsnffrsELQKM-GFEVLGDNDSPVMPIML 405
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 350592247 399 EESTgsrdKDVKLLQEivtgCMDRGIALTQARYleKEEKNLPPPSiRVVVTVEQTEEELDKAASTINEVAQIV 471
Cdd:PLN02483 406 YNPA----KIPAFSRE----CLKQNVAVVVVGF--PATPLLLARA-RICISASHSREDLIKALEVISEVGDLV 467
PRK06939 PRK06939
2-amino-3-ketobutyrate coenzyme A ligase; Provisional
84-460 1.82e-48

2-amino-3-ketobutyrate coenzyme A ligase; Provisional


Pssm-ID: 235893  Cd Length: 397  Bit Score: 172.30  E-value: 1.82e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  84 IVSGPPSHNI-VVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAI 162
Cdd:PRK06939  27 VITSPQGADItVADGKEVINFCANNYLGLANHPELIAAAKAALDSHGFGMASVRFICGTQDLHKELEEKLAKFLGTEDAI 106
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 163 IYSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQeiedqknpRKARVTRRFI 242
Cdd:PRK06939 107 LYSSCFDANGGLFETLLGKEDAIISDALNHASIIDGVRLCKAKRYRYANNDMADLEAQLKEA--------KEAGARHKLI 178
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 243 VVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGInIDDIDLISANMENSLA-SIGGFCCGR 321
Cdd:PRK06939 179 ATDGVFSMDGDIAPLPEICDLADKYDALVMVDDSHAVGFVGENGRGTVEHFGV-MDRVDIITGTLGKALGgASGGYTAGR 257
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 322 SFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKalqgisGLKVAGESISPAFHLQLEES 401
Cdd:PRK06939 258 KEVIDWLRQRSRPYLFSNSLAPAIVAASIKVLELLEESDELRDRLWENARYFRE------GMTAAGFTLGPGEHPIIPVM 331
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 350592247 402 TGsrdkDVKLLQEIVTGCMDRGIALT----------QARylekeeknlpppsIRVVVTVEQTEEELDKA 460
Cdd:PRK06939 332 LG----DAKLAQEFADRLLEEGVYVIgfsfpvvpkgQAR-------------IRTQMSAAHTKEQLDRA 383
PRK05958 PRK05958
8-amino-7-oxononanoate synthase; Reviewed
84-468 1.24e-47

8-amino-7-oxononanoate synthase; Reviewed


Pssm-ID: 235655  Cd Length: 385  Bit Score: 169.95  E-value: 1.24e-47
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  84 IVSGPPSHNIVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAII 163
Cdd:PRK05958  25 PREGGAGRWLVVDGRRMLNFASNDYLGLARHPRLIAAAQQAARRYGAGSGGSRLVTGNSPAHEALEEELAEWFGAERALL 104
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 164 YSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLkeqeiedqknpRKARVTRRFIV 243
Cdd:PRK05958 105 FSSGYAANLAVLTALAGKGDLIVSDKLNHASLIDGARLSRARVRRYPHNDVDALEALL-----------AKWRAGRALIV 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 244 VEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGInIDDIDLIS-ANMENSLASIGGFCCGRS 322
Cdd:PRK05958 174 TESVFSMDGDLAPLAELVALARRHGAWLLVDEAHGTGVLGPQGRGLAAEAGL-AGEPDVILvGTLGKALGSSGAAVLGSE 252
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 323 FVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQGISGLKVAGES-ISPafhLQLees 401
Cdd:PRK05958 253 TLIDYLINRARPFIFTTALPPAQAAAARAALRILRREPERRERLAALIARLRAGLRALGFQLMDSQSaIQP---LIV--- 326
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 350592247 402 tGSRDKDVKLLQEivtgCMDRGIALTQARylekeeknlpPPS-------IRVVVTVEQTEEELDKAASTINEVA 468
Cdd:PRK05958 327 -GDNERALALAAA----LQEQGFWVGAIR----------PPTvpagtsrLRITLTAAHTEADIDRLLEALAEAL 385
2am3keto_CoA TIGR01822
glycine C-acetyltransferase; This model represents a narrowly defined clade of animal and ...
84-467 2.22e-46

glycine C-acetyltransferase; This model represents a narrowly defined clade of animal and bacterial (almost exclusively Proteobacterial) 2-amino-3-ketobutyrate--CoA ligase, now called glycine C-acetyltransferase. This enzyme can act in threonine catabolism. The closest homolog from Bacillus subtilis, and sequences like it, may be functionally equivalent but were not included in the model because of difficulty in finding reports of function. [Energy metabolism, Amino acids and amines]


Pssm-ID: 130881  Cd Length: 393  Bit Score: 166.52  E-value: 2.22e-46
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247   84 IVSGPPSHNIVVN-GKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAI 162
Cdd:TIGR01822  23 IITSPQGADIRVAdGREVLNFCANNYLGLSSHPDLIQAAKDALDEHGFGMSSVRFICGTQDIHKELEAKIAAFLGTEDTI 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  163 IYSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEqeiedqknPRKARVTRRFI 242
Cdd:TIGR01822 103 LYASCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMADLEAQLKE--------ARAAGARHRLI 174
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  243 VVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGInIDDIDLISANMENSL-ASIGGFCCGR 321
Cdd:TIGR01822 175 ATDGVFSMDGVIAPLDEICDLADKYDALVMVDECHATGFLGPTGRGSHELCGV-MGRVDIITGTLGKALgGASGGFTTAR 253
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  322 SFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHkalqgiSGLKVAGESISPAFHLQLEES 401
Cdd:TIGR01822 254 KEVVELLRQRSRPYLFSNSLPPAVVGASIKVLEMLEASNELRDRLWANTRYFR------ERMEAAGFDIKPADHPIIPVM 327
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 350592247  402 TGsrdkDVKLLQEIVTGCMDRGIALT----------QARylekeeknlpppsIRVVVTVEQTEEELDKAASTINEV 467
Cdd:TIGR01822 328 LY----DAVLAQRFARRLLEEGIYVTgffypvvpkgQAR-------------IRVQISAAHTEEQLDRAVEAFTRI 386
5aminolev_synth TIGR01821
5-aminolevulinic acid synthase; This model represents 5-aminolevulinic acid synthase, an ...
100-343 1.31e-34

5-aminolevulinic acid synthase; This model represents 5-aminolevulinic acid synthase, an enzyme for one of two routes to the heme precursor 5-aminolevulinate. The protein is a pyridoxal phosphate-dependent enzyme related to 2-amino-3-ketobutyrate CoA tranferase and 8-amino-7-oxononanoate synthase. This enzyme appears restricted to the alpha Proteobacteria and mitochondrial derivatives. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]


Pssm-ID: 273820  Cd Length: 402  Bit Score: 133.31  E-value: 1.31e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  100 CINfasfNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGF-------ATIA 172
Cdd:TIGR01821  51 CSN----DYLGMGQHPEVLQAMHETLDKYGAGAGGTRNISGTNIPHVELEAELADLHGKESALVFTSGYvandatlATLA 126
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  173 SAIPayskrGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKeqeiedQKNPRKARVtrrfIVVEGLYMNTG 252
Cdd:TIGR01821 127 KIIP-----GCVIFSDELNHASMIEGIRHSGAEKFIFRHNDVAHLEKLLQ------SVDPNRPKI----IAFESVYSMDG 191
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  253 TICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGInIDDIDLISANMENSLASIGGFCCGRSFVIDHQRLSG 332
Cdd:TIGR01821 192 DIAPIEEICDLADKYGALTYLDEVHAVGLYGPRGGGIAERDGL-MHRIDIIEGTLAKAFGVVGGYIAASRKLIDAIRSYA 270
                         250
                  ....*....|.
gi 350592247  333 QGYCFSASLPP 343
Cdd:TIGR01821 271 PGFIFTTSLPP 281
PRK09064 PRK09064
5-aminolevulinate synthase; Validated
100-343 3.66e-34

5-aminolevulinate synthase; Validated


Pssm-ID: 236370  Cd Length: 407  Bit Score: 131.90  E-value: 3.66e-34
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 100 CINfasfNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGF-------ATIA 172
Cdd:PRK09064  52 CSN----DYLGMGQHPKVIEAMIEALDRCGAGAGGTRNISGTNHYHVELERELADLHGKEAALVFTSGYvsndatlSTLA 127
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 173 SAIPayskrGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQEIEDQKnprkarvtrrFIVVEGLYMNTG 252
Cdd:PRK09064 128 KLIP-----DCVIFSDELNHASMIEGIRRSRCEKHIFRHNDVAHLEELLAAADPDRPK----------LIAFESVYSMDG 192
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 253 TICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGInIDDIDLISANMENSLASIGGFCCGRSFVIDHQRLSG 332
Cdd:PRK09064 193 DIAPIAEICDLADKYNALTYLDEVHAVGMYGPRGGGIAERDGL-MDRIDIIEGTLAKAFGVMGGYIAGSAALVDAVRSYA 271
                        250
                 ....*....|.
gi 350592247 333 QGYCFSASLPP 343
Cdd:PRK09064 272 PGFIFTTSLPP 282
PRK13392 PRK13392
5-aminolevulinate synthase; Provisional
98-343 1.11e-29

5-aminolevulinate synthase; Provisional


Pssm-ID: 184023  Cd Length: 410  Bit Score: 118.80  E-value: 1.11e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  98 KECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPA 177
Cdd:PRK13392  46 RRVTIWCSNDYLGMGQHPDVIGAMVDALDRYGAGAGGTRNISGTSHPHVLLERELADLHGKESALLFTSGYVSNDAALST 125
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 178 YSKR--GDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQEIEDQKnprkarvtrrFIVVEGLYMNTGTIC 255
Cdd:PRK13392 126 LGKLlpGCVILSDALNHASMIEGIRRSGAEKQVFRHNDLADLEEQLASVDPDRPK----------LIAFESVYSMDGDIA 195
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 256 PLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGInIDDIDLISANMENSLASIGGFCCGRSFVIDHQRLSGQGY 335
Cdd:PRK13392 196 PIEAICDLADRYNALTYVDEVHAVGLYGARGGGIAERDGL-MDRIDMIQGTLAKAFGCLGGYIAASADLIDFVRSFAPGF 274

                 ....*...
gi 350592247 336 CFSASLPP 343
Cdd:PRK13392 275 IFTTALPP 282
PRK13393 PRK13393
5-aminolevulinate synthase; Provisional
105-343 1.34e-29

5-aminolevulinate synthase; Provisional


Pssm-ID: 184024  Cd Length: 406  Bit Score: 118.27  E-value: 1.34e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 105 SFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGF-------ATIASAIPa 177
Cdd:PRK13393  52 SNDYLGMGQHPAVLAAMHEALDTCGAGAGGTRNISGTNHYHVLLEAELADLHGKEAALLFTSGYvsnwaalSTLGSRLP- 130
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 178 yskrGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQeieDQKNPrkarvtrRFIVVEGLYMNTGTICPL 257
Cdd:PRK13393 131 ----GCVILSDELNHASMIEGIRHSRAEKRIFRHNDPADLERKLSDL---DPHRP-------KLVAFESVYSMDGDIAPI 196
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 258 PELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGInIDDIDLISANMENSLASIGGFCCGRSFVIDHQRLSGQGYCF 337
Cdd:PRK13393 197 AEICDVAEKHGAMTYLDEVHAVGLYGPRGGGIAEREGL-ADRLTIIEGTLAKAFGVMGGYITGSAALCDFIRSFASGFIF 275

                 ....*.
gi 350592247 338 SASLPP 343
Cdd:PRK13393 276 TTSLPP 281
PRK07179 PRK07179
hypothetical protein; Provisional
97-343 3.21e-19

hypothetical protein; Provisional


Pssm-ID: 180866  Cd Length: 407  Bit Score: 88.14  E-value: 3.21e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  97 GKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIP 176
Cdd:PRK07179  53 GPDAIILQSNDYLNLSGHPDIIKAQIAALQEEGDSLVMSAVFLHDDSPKPQFEKKLAAFTGFESCLLCQSGWAANVGLLQ 132
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 177 AYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLkeqeiedqknprkarvtRRF----IVVEGLYMNTG 252
Cdd:PRK07179 133 TIADPNTPVYIDFFAHMSLWEGVRAAGAQAHPFRHNDVDHLRRQI-----------------ERHgpgiIVVDSVYSTTG 195
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 253 TICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGINiDDIDLISANMENSLASIGGFCCGRSFVIDHQRLSG 332
Cdd:PRK07179 196 TIAPLADIVDIAEEFGCVLVVDESHSLGTHGPQGAGLVAELGLT-SRVHFITASLAKAFAGRAGIITCPRELAEYVPFVS 274
                        250
                 ....*....|.
gi 350592247 333 QGYCFSASLPP 343
Cdd:PRK07179 275 YPAIFSSTLLP 285
PRK05937 PRK05937
8-amino-7-oxononanoate synthase; Provisional
101-294 1.09e-18

8-amino-7-oxononanoate synthase; Provisional


Pssm-ID: 102071  Cd Length: 370  Bit Score: 85.99  E-value: 1.09e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 101 INFASFNFLGLLDNPRVKAAALASLKKY-------GVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIAS 173
Cdd:PRK05937   7 IDFVTNDFLGFSRSTTLVHEVEKRYRLYceqfphaQLGYGGSRAILGPSSLLDDLEHKIAHFHGAPEAFIVPSGYMANLG 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 174 AIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQeiedqknpRKARVTRRFIVVEGLYMNTGT 253
Cdd:PRK05937  87 LCAHLSSVTDYVLWDEQVHISVVYSLSVISGKHQSFRHNDLDHLESLLESC--------RAVSFGRIFIFVCSVYSFKGT 158
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|.
gi 350592247 254 ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFG 294
Cdd:PRK05937 159 LAPLEQIIALSKKYHAHLIVDEAHAMGIFGDDGKGFCHSLG 199
PLN02955 PLN02955
8-amino-7-oxononanoate synthase
98-459 1.64e-17

8-amino-7-oxononanoate synthase


Pssm-ID: 178541  Cd Length: 476  Bit Score: 83.57  E-value: 1.64e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  98 KECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPA 177
Cdd:PLN02955 102 KKLLLFSGNDYLGLSSHPTISNAAANAAKEYGMGPKGSALICGYTTYHRLLESSLADLKKKEDCLVCPTGFAANMAAMVA 181
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 178 YSKRGDIVFVD-------KAACF-------AIQKGLQ-ASR---SDIKLFEHNDMEDLERLLKEQEIEdqknprkarvtR 239
Cdd:PLN02955 182 IGSVASLLAASgkplkneKVAIFsdalnhaSIIDGVRlAERqgnVEVFVYRHCDMYHLNSLLSSCKMK-----------R 250
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 240 RFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGINiDDIDLISANMENSLASIGGF-- 317
Cdd:PLN02955 251 KVVVTDSLFSMDGDFAPMEELSQLRKKYGFLLVIDDAHGTFVCGENGGGVAEEFNCE-ADVDLCVGTLSKAAGCHGGFia 329
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 318 CCGRSFVIDHQRlsGQGYCFSASLP-PLLAAAAIealnimeenpGIFAVLKEKCKRIH-----KALQGISGLKVAGESIS 391
Cdd:PLN02955 330 CSKKWKQLIQSR--GRSFIFSTAIPvPMAAAAYA----------AVVVARKEKWRRKAiwervKEFKALSGVDISSPIIS 397
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 350592247 392 pafhlqleestgsrdkdvkllqeIVTGCMDRgiALTQARYLEK--------EEKNLPPPS--IRVVVTVEQTEEELDK 459
Cdd:PLN02955 398 -----------------------LVVGNQEK--ALKASRYLLKsgfhvmaiRPPTVPPNScrLRVTLSAAHTTEDVKK 450
PRK07505 PRK07505
hypothetical protein; Provisional
97-317 2.43e-17

hypothetical protein; Provisional


Pssm-ID: 181006  Cd Length: 402  Bit Score: 82.33  E-value: 2.43e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  97 GKECINFASFNFLGLLDNPRVKAAALASLKKYGV-GTCGPRGFYgTFDVHLDLEDRLAKFMKTEEAIIYSYGFAT----- 170
Cdd:PRK07505  45 GHTFVNFVSCSYLGLDTHPAIIEGAVDALKRTGSlHLSSSRTRV-RSQILKDLEEALSELFGASVLTFTSCSAAHlgilp 123
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 171 -IASAIPAYSKRGDIVFvDKAA--CFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQEiedqknprkarvtRRFIVVEGL 247
Cdd:PRK07505 124 lLASGHLTGGVPPHMVF-DKNAhaSLNILKGICADETEVETIDHNDLDALEDICKTNK-------------TVAYVADGV 189
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 350592247 248 YmNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRG-VTEHFGINIDDIDLISANMENSLASIGGF 317
Cdd:PRK07505 190 Y-SMGGIAPVKELLRLQEKYGLFLYIDDAHGLSIYGKNGEGyVRSELDYRLNERTIIAASLGKAFGASGGV 259
PRK07049 PRK07049
methionine gamma-lyase; Validated
148-185 3.88e-03

methionine gamma-lyase; Validated


Pssm-ID: 180809  Cd Length: 427  Bit Score: 38.11  E-value: 3.88e-03
                         10        20        30
                 ....*....|....*....|....*....|....*...
gi 350592247 148 LEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIV 185
Cdd:PRK07049  88 VEDRLAVYEGAESAALFSSGMSAIATTLLAFVRPGDVI 125
BioF COG0156
7-keto-8-aminopelargonate synthetase or related enzyme [Coenzyme transport and metabolism]; ...
81-467 1.16e-96

7-keto-8-aminopelargonate synthetase or related enzyme [Coenzyme transport and metabolism]; linked to 3D-structure


Pssm-ID: 223234 [Multi-domain]  Cd Length: 388  Bit Score: 299.17  E-value: 1.16e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  81 NYNIVSGPPSHNIVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEE 160
Cdd:COG0156   22 GLRALDRRQGLAIRADGRKVLNFCSNDYLGLASHPELIEAAKAAIRRYGVGAGGSRLISGTSDLHVELEEELADFLGAEA 101
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 161 AIIYSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEqeiedqknPRKARVTRR 240
Cdd:COG0156  102 ALLFSSGFVANLGLLSALLKKGDLIFSDELNHASIIDGIRLSRAEVRRFKHNDLDHLEALLEE--------ARENGARRK 173
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 241 FIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLISANMENSLASIGGFCCG 320
Cdd:COG0156  174 LIVTEGVFSMDGDIAPLPELVELAEKYGALLYVDEAHAVGVLGPNGRGLAEHFGLEPEEVDIIVGTLGKALGSSGGYIAG 253
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247 321 RSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQgISGLKVAGeSISPAFHLQLee 400
Cdd:COG0156  254 SAALIDYLRNRARPFIFSTALPPAVAAAALAALRILEEGPERRERLQELAAFFRSLLK-ALGLVLLP-SESPIIPVIL-- 329
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 350592247 401 stgsrdKDVKLLQEIVTGCMDRGIALTQARY--LEKEEknlppPSIRVVVTVEQTEEELDKAASTINEV 467
Cdd:COG0156  330 ------GDEERALEASRALLEEGIYVSAIRPptVPKGT-----ARLRITLTAAHTEEDIDRLAEALSEV 387
bioF TIGR00858
8-amino-7-oxononanoate synthase; 7-keto-8-aminopelargonic acid synthetase is an alternate name. ...
84-464 5.10e-61

8-amino-7-oxononanoate synthase; 7-keto-8-aminopelargonic acid synthetase is an alternate name. This model represents 8-amino-7-oxononanoate synthase, the BioF protein of biotin biosynthesis. This model is based on a careful phylogenetic analysis to separate members of this family from 2-amino-3-ketobutyrate and other related pyridoxal phosphate-dependent enzymes. In several species, including Staphylococcus and Coxiella, a candidate 8-amino-7-oxononanoate synthase is confirmed by location in the midst of a biotin biosynthesis operon but scores below the trusted cutoff of this model. [Biosynthesis of cofactors, prosthetic groups, and carriers, Biotin]


Pssm-ID: 273303 [Multi-domain]  Cd Length: 360  Bit Score: 205.19  E-value: 5.10e-61
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247   84 IVSGPPSHNIVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAII 163
Cdd:TIGR00858   2 PLDRGPGPEVVRDGRRLLNFSSNDYLGLASHPEVIQAAQQGAEQYGAGSTASRLVSGNSPLHEELEEELAEWKGTEAALL 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  164 YSYGFATIASAIPAYSKRGDIVFVDKAACFAIQKGLQASRSDIKLFEHNDMEDLERLLKEQEIEDQKnprkarvtrrFIV 243
Cdd:TIGR00858  82 FSSGYLANVGVISALVGKGDLILSDALNHASLIDGCRLSGARVRRYRHNDVEHLERLLEKNRGERRK----------LIV 151
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  244 VEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHFGINIDDIDLISANMENSLASIGGFCCGRSF 323
Cdd:TIGR00858 152 TDGVFSMDGDIAPLPQLVALAERYGAWLMVDDAHGTGVLGEDGRGTLEHFGLKPEPVDIQVGTLSKALGSYGAYVAGSQA 231
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  324 VIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQGISGLKVAGES-ISPAFhlqleesT 402
Cdd:TIGR00858 232 LIDYLINRARTLIFSTALPPAVAAAALAALELIQEEPWRREKLLALIARLRAGLEALGFTLMPSCTpIVPVI-------I 304
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 350592247  403 GSRDKDVkllqEIVTGCMDRGIALTQARylekeeknlpPPS-------IRVVVTVEQTEEELDKAASTI 464
Cdd:TIGR00858 305 GDNASAL----ALAEELQQQGIFVGAIR----------PPTvpagtsrLRLTLSAAHTPGDIDRLAEAL 359
Aminotran_1_2 pfam00155
Aminotransferase class I and II;
98-464 5.08e-25

Aminotransferase class I and II;


Pssm-ID: 249636 [Multi-domain]  Cd Length: 351  Bit Score: 104.31  E-value: 5.08e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247   98 KECINFASFNFLGLLdnprVKAAALASLKkygVGTCGPRGFYGTFDVHLDLEDRLAKFM--------KTEEAIIYSYGFA 169
Cdd:pfam00155   1 TDKINLGSNEYLGDT----LPAVAKAEKD---ALAGGTRNLYGPTDGLPELREALAKFLgrspvlklDREAAVVFGSGAG 73
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  170 TIASAIPAYSK-RGDIVFVDKAACFAIQKGLQASRSDIKLFE-------HNDMEDLERLLKEQeiedqknprkarvtRRF 241
Cdd:pfam00155  74 ANIEALIFLLAnPGDAILVPAPTYASYIRIARLAGGEVVRYPlydsndfHLDFDALEAALKEK--------------PKV 139
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  242 IVVEGLYMNTGTICPLPELVKL---KYKYKARIFLEESLSFGVLGEHGRGVTEHFGIniDDIDLISAN-MENSLASIG-- 315
Cdd:pfam00155 140 VLHTSPHNPTGTVATLEELEKLldlAKEHNILLLVDEAYAGFVFGSPDAVATRALLA--EGPNLLVVGsFSKAFGLAGwr 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  316 -GFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCKRIHKALQGIsGLKVAGeSISPAF 394
Cdd:pfam00155 218 vGYILGNAAVISQLRKLARPFYSSTHLQAAAAAALSDPLLVASELEEMRQRIKERRDYLRDGLEAA-GLSVLP-SQAGFF 295
                         330       340       350       360       370       380       390
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350592247  395 HLQLeestGSRDKDVKLLQEIVTgcmDRGIALTQARYLEKeeknlpPPSIRVVVTVeQTEEELDKAASTI 464
Cdd:pfam00155 296 LLTG----LDPETAKELAQVLLE---EVGVYVTPGSSPGV------PGWLRITVAG-GTEEELEELLEAI 351
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH