NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|350538387|ref|NP_001233518|]
View 

extracellular matrix protein 1 precursor [Pan troglodytes]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ECM1 pfam05782
Extracellular matrix protein 1 (ECM1); This family consists of several eukaryotic ...
1-540 0e+00

Extracellular matrix protein 1 (ECM1); This family consists of several eukaryotic extracellular matrix protein 1 (ECM1) sequences. ECM1 has been shown to regulate endochondral bone formation, stimulate the proliferation of endothelial cells and induce angiogenesis. Mutations in the ECM1 gene can cause lipoid proteinosis, a disorder which causes generalised thickening of skin, mucosae and certain viscera. Classical features include beaded eyelid papules and laryngeal infiltration leading to hoarseness.


:

Pssm-ID: 147759  Cd Length: 419  Bit Score: 770.72  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387    1 MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPE----HFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQ 76
Cdd:pfam05782   1 MGTVSRAALVLACLAVASAASEGGFKASGQRELTPErlfqHLQEVGYAAPPSPPLSRRLPVDHPVTSQHDPPFEGQSEVQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   77 PPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRS 156
Cdd:pfam05782  81 PPPSPEDIPVYEEDWPTFLNPNVDKAGPAVPQEAIPLQKELPPPQVPIEQKEVKPAPLADQSPPEPESWNPAQHCQQGRS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  157 QGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLV 236
Cdd:pfam05782 161 RGGWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGETLNVLETGYSRCCRCRSDTNRLDCAKLV 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  237 weeamsrfceaefsvktrphwcctrqgearfscfqeeapqphyqlracpshqpdissglelpfppgvptldniknichlr 316
Cdd:pfam05782     --------------------------------------------------------------------------------
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  317 rfrsvprnlpatdplqrellaliqlerefqrccrqgnnhtctwkaWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECF 396
Cdd:pfam05782 241 ---------------------------------------------WEDTLDGYCDRELAIKTHHHSCCHYPPSPARDECF 275
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  397 ARRAPYPNYDRDILTIDISRVTPNLMGHLCGNQRILTKHKHIPGLIHNMTAHCCDLPFPEQACCAEEEKLTFINDLCGPR 476
Cdd:pfam05782 276 ARRAPYPNYDRDILTLDLSRVTPNLMGHLCGNGRVLSKHKQIPGLIQNMTARCCDLPFPEQACCAEEEKLAFIENLCGPR 355
                         490       500       510       520       530       540
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 350538387  477 RNFWRDPALCCYLSPGDEQVNCFNMNYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE 540
Cdd:pfam05782 356 RNSWRDPALCCDLSPGDEQINCFNTNYLRNVALVAGDTGNAKGLGEQGPTRGTNASPTSEPKEE 419
 
Name Accession Description Interval E-value
ECM1 pfam05782
Extracellular matrix protein 1 (ECM1); This family consists of several eukaryotic ...
1-540 0e+00

Extracellular matrix protein 1 (ECM1); This family consists of several eukaryotic extracellular matrix protein 1 (ECM1) sequences. ECM1 has been shown to regulate endochondral bone formation, stimulate the proliferation of endothelial cells and induce angiogenesis. Mutations in the ECM1 gene can cause lipoid proteinosis, a disorder which causes generalised thickening of skin, mucosae and certain viscera. Classical features include beaded eyelid papules and laryngeal infiltration leading to hoarseness.


Pssm-ID: 147759  Cd Length: 419  Bit Score: 770.72  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387    1 MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPE----HFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQ 76
Cdd:pfam05782   1 MGTVSRAALVLACLAVASAASEGGFKASGQRELTPErlfqHLQEVGYAAPPSPPLSRRLPVDHPVTSQHDPPFEGQSEVQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   77 PPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRS 156
Cdd:pfam05782  81 PPPSPEDIPVYEEDWPTFLNPNVDKAGPAVPQEAIPLQKELPPPQVPIEQKEVKPAPLADQSPPEPESWNPAQHCQQGRS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  157 QGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLV 236
Cdd:pfam05782 161 RGGWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGETLNVLETGYSRCCRCRSDTNRLDCAKLV 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  237 weeamsrfceaefsvktrphwcctrqgearfscfqeeapqphyqlracpshqpdissglelpfppgvptldniknichlr 316
Cdd:pfam05782     --------------------------------------------------------------------------------
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  317 rfrsvprnlpatdplqrellaliqlerefqrccrqgnnhtctwkaWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECF 396
Cdd:pfam05782 241 ---------------------------------------------WEDTLDGYCDRELAIKTHHHSCCHYPPSPARDECF 275
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  397 ARRAPYPNYDRDILTIDISRVTPNLMGHLCGNQRILTKHKHIPGLIHNMTAHCCDLPFPEQACCAEEEKLTFINDLCGPR 476
Cdd:pfam05782 276 ARRAPYPNYDRDILTLDLSRVTPNLMGHLCGNGRVLSKHKQIPGLIQNMTARCCDLPFPEQACCAEEEKLAFIENLCGPR 355
                         490       500       510       520       530       540
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 350538387  477 RNFWRDPALCCYLSPGDEQVNCFNMNYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE 540
Cdd:pfam05782 356 RNSWRDPALCCDLSPGDEQINCFNTNYLRNVALVAGDTGNAKGLGEQGPTRGTNASPTSEPKEE 419
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
30-153 2.08e-09

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 59.02  E-value: 2.08e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   30 QRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQhgPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQE 109
Cdd:pfam09770 211 PEQVQPQQFLPAPSQAPAQPPLPPQLPQQPPPLQQ--PQFPGLSQQMPPPPPQPPQQQQQPPQPQAQPPPQNQPTPHPGL 288
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
gi 350538387  110 AVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQ 153
Cdd:pfam09770 289 PQGQNAPLPPPQQPQLLPLVQQPQGQQRGPQFREQLVQLSQQQR 332
PHA03247 PHA03247
large tegument protein UL36; Provisional
18-148 4.51e-05

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 45.31  E-value: 4.51e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   18 SAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPmdhpdssQHGPPFEGQSQVQPPPSQEatPLQQEKLLPAQLP 97
Cdd:PHA03247 2849 SLPLGGSVAPGGDVRRRPPSRSPAAKPAAPARPPVRRLA-------RPAVSRSTESFALPPDQPE--RPPQPQAPPPPQP 2919
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 350538387   98 AEKEVGPPLPQEAVPLQKELPSLQHPNEQkegtPAPFGDQSHPEPESWNAA 148
Cdd:PHA03247 2920 QPQPPPPPQPQPPPPPPPRPQPPLAPTTD----PAGAGEPSGAVPQPWLGA 2966
PRK03427 PRK03427
cell division protein ZipA; Provisional
17-133 1.50e-04

cell division protein ZipA; Provisional


Pssm-ID: 235124 [Multi-domain]  Cd Length: 333  Bit Score: 42.71  E-value: 1.50e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  17 ASAASEGGFTATGQRQlRPEHFQEVGYAAPPSPPLSRSLPMDH-PDSSQHGPPFEGQSQVQPPPSQEAT--PLQQEKllP 93
Cdd:PRK03427  71 VNHAPANAQEHEAARP-SPQHQYQPPYASAQPRQPVQQPPEAQvPPQHAPRPAQPAPQPVQQPAYQPQPeqPLQQPV--S 147
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 350538387  94 AQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAP 133
Cdd:PRK03427 148 PQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPEPVAEPAP 187
ZipA COG3115
Cell division protein [Cell division and chromosome partitioning]
35-136 8.48e-03

Cell division protein [Cell division and chromosome partitioning]


Pssm-ID: 225657 [Multi-domain]  Cd Length: 324  Bit Score: 37.15  E-value: 8.48e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  35 PEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLpaeKEVGPPLPQEAVPLq 114
Cdd:COG3115   86 PQHQYQPEYASAQIKIPVPQPPQISDPPAHPQPTQPALDQEQPPEEARQPVLPQEAPAPQPV---HSAAPQPAVQTVQP- 161
                         90       100
                 ....*....|....*....|..
gi 350538387 115 keLPSLQHPNEQKEGTPAPFGD 136
Cdd:COG3115  162 --AVPEQQVQPEEVVEPAPEVK 181
 
Name Accession Description Interval E-value
ECM1 pfam05782
Extracellular matrix protein 1 (ECM1); This family consists of several eukaryotic ...
1-540 0e+00

Extracellular matrix protein 1 (ECM1); This family consists of several eukaryotic extracellular matrix protein 1 (ECM1) sequences. ECM1 has been shown to regulate endochondral bone formation, stimulate the proliferation of endothelial cells and induce angiogenesis. Mutations in the ECM1 gene can cause lipoid proteinosis, a disorder which causes generalised thickening of skin, mucosae and certain viscera. Classical features include beaded eyelid papules and laryngeal infiltration leading to hoarseness.


Pssm-ID: 147759  Cd Length: 419  Bit Score: 770.72  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387    1 MGTTARAALVLTYLAVASAASEGGFTATGQRQLRPE----HFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQ 76
Cdd:pfam05782   1 MGTVSRAALVLACLAVASAASEGGFKASGQRELTPErlfqHLQEVGYAAPPSPPLSRRLPVDHPVTSQHDPPFEGQSEVQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   77 PPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQDRS 156
Cdd:pfam05782  81 PPPSPEDIPVYEEDWPTFLNPNVDKAGPAVPQEAIPLQKELPPPQVPIEQKEVKPAPLADQSPPEPESWNPAQHCQQGRS 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  157 QGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLV 236
Cdd:pfam05782 161 RGGWGHRLDGFPPGRPSPDNLKQICLPERQHVVYGPWNLPQTGYSHLSRQGETLNVLETGYSRCCRCRSDTNRLDCAKLV 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  237 weeamsrfceaefsvktrphwcctrqgearfscfqeeapqphyqlracpshqpdissglelpfppgvptldniknichlr 316
Cdd:pfam05782     --------------------------------------------------------------------------------
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  317 rfrsvprnlpatdplqrellaliqlerefqrccrqgnnhtctwkaWEDTLDKYCDREYAVKTHHHLCCRHPPSPTRDECF 396
Cdd:pfam05782 241 ---------------------------------------------WEDTLDGYCDRELAIKTHHHSCCHYPPSPARDECF 275
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  397 ARRAPYPNYDRDILTIDISRVTPNLMGHLCGNQRILTKHKHIPGLIHNMTAHCCDLPFPEQACCAEEEKLTFINDLCGPR 476
Cdd:pfam05782 276 ARRAPYPNYDRDILTLDLSRVTPNLMGHLCGNGRVLSKHKQIPGLIQNMTARCCDLPFPEQACCAEEEKLAFIENLCGPR 355
                         490       500       510       520       530       540
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 350538387  477 RNFWRDPALCCYLSPGDEQVNCFNMNYLRNVALVSGDTENAKGQGEQGSTGGTNISSTSEPKEE 540
Cdd:pfam05782 356 RNSWRDPALCCDLSPGDEQINCFNTNYLRNVALVAGDTGNAKGLGEQGPTRGTNASPTSEPKEE 419
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
30-153 2.08e-09

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 59.02  E-value: 2.08e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   30 QRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQhgPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQE 109
Cdd:pfam09770 211 PEQVQPQQFLPAPSQAPAQPPLPPQLPQQPPPLQQ--PQFPGLSQQMPPPPPQPPQQQQQPPQPQAQPPPQNQPTPHPGL 288
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
gi 350538387  110 AVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQHCQQ 153
Cdd:pfam09770 289 PQGQNAPLPPPQQPQLLPLVQQPQGQQRGPQFREQLVQLSQQQR 332
DUF4106 pfam13388
Protein of unknown function (DUF4106); This family of proteins are found in large numbers in ...
41-126 2.81e-05

Protein of unknown function (DUF4106); This family of proteins are found in large numbers in the Trichomonas vaginalis proteome. The function of this protein is unknown.


Pssm-ID: 257714 [Multi-domain]  Cd Length: 422  Bit Score: 45.04  E-value: 2.81e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   41 VGYAAPPSPP-------LSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEAT------PLQQEKLLPAQLPAEKEVGPPLP 107
Cdd:pfam13388 168 SGTYIPPNPPreapapgLPKTFTSSHGHRHRHAPKPTQQPTVQNPAQQPTVqnpaqqPQQQPQQQPVQPAQQPTPQNPAQ 247
                          90
                  ....*....|....*....
gi 350538387  108 QEAVPLQKELPSLQHPNEQ 126
Cdd:pfam13388 248 QPPQTEQGHKRSREQGNQE 266
PHA03247 PHA03247
large tegument protein UL36; Provisional
18-148 4.51e-05

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 45.31  E-value: 4.51e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   18 SAASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPmdhpdssQHGPPFEGQSQVQPPPSQEatPLQQEKLLPAQLP 97
Cdd:PHA03247 2849 SLPLGGSVAPGGDVRRRPPSRSPAAKPAAPARPPVRRLA-------RPAVSRSTESFALPPDQPE--RPPQPQAPPPPQP 2919
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 350538387   98 AEKEVGPPLPQEAVPLQKELPSLQHPNEQkegtPAPFGDQSHPEPESWNAA 148
Cdd:PHA03247 2920 QPQPPPPPQPQPPPPPPPRPQPPLAPTTD----PAGAGEPSGAVPQPWLGA 2966
PRK03427 PRK03427
cell division protein ZipA; Provisional
17-133 1.50e-04

cell division protein ZipA; Provisional


Pssm-ID: 235124 [Multi-domain]  Cd Length: 333  Bit Score: 42.71  E-value: 1.50e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  17 ASAASEGGFTATGQRQlRPEHFQEVGYAAPPSPPLSRSLPMDH-PDSSQHGPPFEGQSQVQPPPSQEAT--PLQQEKllP 93
Cdd:PRK03427  71 VNHAPANAQEHEAARP-SPQHQYQPPYASAQPRQPVQQPPEAQvPPQHAPRPAQPAPQPVQQPAYQPQPeqPLQQPV--S 147
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 350538387  94 AQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGTPAP 133
Cdd:PRK03427 148 PQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPEPVAEPAP 187
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
30-140 4.41e-04

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 41.69  E-value: 4.41e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   30 QRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHG-----PPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGP 104
Cdd:pfam09770 155 SLEEVEAQLQQRQQAPQLPQPPQQVLPQGMPPRQAAFpqqgpPEQPPGYPQPPQGHPEQVQPQQFLPAPSQAPAQPPLPP 234
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 350538387  105 PLPQEAVPLQKElPSLQHPNEQKEGTPAPFGDQSHP 140
Cdd:pfam09770 235 QLPQQPPPLQQP-QFPGLSQQMPPPPPQPPQQQQQP 269
DUF1421 pfam07223
Protein of unknown function (DUF1421); This family represents a conserved region approximately ...
47-183 1.70e-03

Protein of unknown function (DUF1421); This family represents a conserved region approximately 350 residues long within a number of plant proteins of unknown function.


Pssm-ID: 254110 [Multi-domain]  Cd Length: 357  Bit Score: 39.54  E-value: 1.70e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   47 PSPPLSRSLPMD--HPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEA---VPLQKELPSLQ 121
Cdd:pfam07223 108 QSVPQQPTPQQEpyYPPPSQPQPPPAQQPQAQQPQPPPQVPQQQQYQSPPQQPQYQQNPPPQAQSApqvSGLYPEESPYQ 187
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 350538387  122 HPNE-QKEGTPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGhrldgfPPGRPSPDNLNQICLP 183
Cdd:pfam07223 188 PQSYpPNEPLPSSMAMQPPYSGAPPSQQFYGPPQPSPYMYG------GPGGRPNSGFPSGQQP 244
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
8-148 2.86e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 39.02  E-value: 2.86e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   8 ALVLTYLAVASAASEGGFTATGQRQLRPEhfqeVGYAAPPSPPLSRSLPmdhpdssqhgpPFEGQSQVQPPPSQEATPLQ 87
Cdd:PRK14950 354 AVIEALLVPVPAPQPAKPTAAAPSPVRPT----PAPSTRPKAAAAANIP-----------PKEPVRETATPPPVPPRPVA 418
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 350538387  88 QekllpaQLPAEKEVGPPLPQEAVPLQKelpslqhpneqkegtpAPFGDQSHPEPESWNAA 148
Cdd:PRK14950 419 P------PVPHTPESAPKLTRAAIPVDE----------------KPKYTPPAPPKEEEKAL 457
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
5-174 3.19e-03

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 39.00  E-value: 3.19e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387    5 ARAALVLTYLAVASAASEGGFTATGQRQLRPEH--FQEVGYAAPPSPPLSRSLPMDHPDS--SQHGPPFEGqsqVQPPPS 80
Cdd:PHA03307   86 STPTWSLSTLAPASPAREGSPTPPGPSSPDPPPptPPPASPPPSPAPDLSEMLRPVGSPGppPAASPPAAG---ASPAAV 162
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   81 QEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHP---------NEQKEGTPAPFGDQ-SHPEPESWNAAQH 150
Cdd:PHA03307  163 ASDAASSRQAALPLSSPEETARAPSSPPAEPPPSTPPAAASPRpprrsspisASASSPAPAPGRSAaDDAGASSSDSSSS 242
                         170       180
                  ....*....|....*....|....
gi 350538387  151 CQQDRSQGGWGHRLDGFPPGRPSP 174
Cdd:PHA03307  243 ESSGCGWGPENECPLPRPAPITLP 266
PRK10263 PRK10263
DNA translocase FtsK; Provisional
47-142 3.97e-03

DNA translocase FtsK; Provisional


Pssm-ID: 236669 [Multi-domain]  Cd Length: 1355  Bit Score: 38.53  E-value: 3.97e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   47 PSPPL--SRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPN 124
Cdd:PRK10263  740 PHEPLftPIVEPVQQPQQPVAPQQQYQQPQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQPQYQQPQQPVAPQPQYQQ 819
                          90
                  ....*....|....*...
gi 350538387  125 EQKEGTPAPFGDQSHPEP 142
Cdd:PRK10263  820 PQQPVAPQPQYQQPQQPV 837
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
2-192 7.61e-03

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 255543 [Multi-domain]  Cd Length: 806  Bit Score: 37.83  E-value: 7.61e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387    2 GTTARAALVLTYLAVASAASEGG--------FTATGQRQLRPEHFQEVGYaaPPSPPLSRSLpMDHPDSSQHGPPfEGQS 73
Cdd:pfam09770  66 GETAKLSAAVRYNQNAPGAPSVGpdsdlsqkTSTFSPCQSGYEASTDPEY--IPDLQPDPSL-WGTAPKPEPQPP-QAPE 141
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387   74 QVQPPPSQEATPLQQEKlLPAQL---PAEKEVGPPlPQEAVPLQKELPSLQHPNEQKEGTPAPFGDQSHPEPESWNAAQH 150
Cdd:pfam09770 142 SQPQPQTPAQKMLSLEE-VEAQLqqrQQAPQLPQP-PQQVLPQGMPPRQAAFPQQGPPEQPPGYPQPPQGHPEQVQPQQF 219
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 350538387  151 CQQDRSQggwghrldgfPPGRPSPDNLNQICLPNRQHVVYGP 192
Cdd:pfam09770 220 LPAPSQA----------PAQPPLPPQLPQQPPPLQQPQFPGL 251
ZipA COG3115
Cell division protein [Cell division and chromosome partitioning]
35-136 8.48e-03

Cell division protein [Cell division and chromosome partitioning]


Pssm-ID: 225657 [Multi-domain]  Cd Length: 324  Bit Score: 37.15  E-value: 8.48e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 350538387  35 PEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLpaeKEVGPPLPQEAVPLq 114
Cdd:COG3115   86 PQHQYQPEYASAQIKIPVPQPPQISDPPAHPQPTQPALDQEQPPEEARQPVLPQEAPAPQPV---HSAAPQPAVQTVQP- 161
                         90       100
                 ....*....|....*....|..
gi 350538387 115 keLPSLQHPNEQKEGTPAPFGD 136
Cdd:COG3115  162 --AVPEQQVQPEEVVEPAPEVK 181
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH