NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|349587512|pdb|1VU0|Z]
View 

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Parvo_coat pfam00740
Parvovirus coat protein VP2; This protein, together with VP1 forms a capsomer. Both of these ...
1-498 0e+00

Parvovirus coat protein VP2; This protein, together with VP1 forms a capsomer. Both of these proteins are formed from the same transcript using alternative splicing. As a result, VP1 and VP2 differ only in the N-terminal region of VP1. VP2 is involved in packaging the viral DNA.


:

Pssm-ID: 250098  Cd Length: 521  Bit Score: 639.78  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z          1 GADGVGNASGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISS-ASTGASNDNHYFGYSTPWGYFDFNRFHCHFSPR 79
Cdd:pfam00740   1 GGGGVGNSTGGWHGGTTFSDNEVTTTSTRTWHLPMYNNHLYKRISVhNTSDTNADDPHMGISTPWSYFDFNAFGVHFSPR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z         80 DWQRLINNNWGFRPKRLNFKLFNIQVKEVTTNDGV-TTIANNLTSTVQVFSDSEYQLPYVLGSAHQGCLPPFPADVFMIP 158
Cdd:pfam00740  81 DWQRLINNYWGIRPKSLTVEIFNIVVKDVTTGDGAtTTVNNDLTATVQVFLDSNYQLPYVLGAGQEGTLPFLPWKVYKLP 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z        159 QYGYL--------TLNNGS---QAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYL 227
Cdd:pfam00740 161 QYGYYtvgdllsvTLDGNSttvNSTERSAFYTLENFPIQLLRTGDNFETTYEFPDVPFKLTHTWQQNLDLGMNPLVDQRL 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z        228 YYLNRTQNQSGSAQNKDLlFSRGSPAGMSVQPKNWLPGP---CYRQQRVSKTKTDNN-----NSNFTWTGASKYNLNGRE 299
Cdd:pfam00740 241 YVLTSLPGTGTGTATLRV-FRKLRKGDTAQQPKNWLPGPaqvMVPQQNFEASSGGPFkvpvvPSWNTRGTEQPTPGNDRE 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z        300 SIINPGTAMASHKDDKDKFFPMSGVMIFGKESAGASNTA---LDNVMITDEEEIKATNPVATERFGTVAVNLQSSSTDPA 376
Cdd:pfam00740 320 ANGAPRPTYGTQHGGGTASIALQERLTFDAKPEEAGRTTqqdFNQRLPTSEEEILPLNAVNVDTYGLLPTNPQGGKTDQN 399
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z        377 TGDVHVMGALPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPPaEFSATKFASFIT 456
Cdd:pfam00740 400 YTNVFNSYGPPGAVWNPRPIYYQGQIWDKIPNTDHKFHLHPLLGGVGLNNPPPQIFVKLTPNPTPPT-TFTDSGTDSRIN 478
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|...
1VU0_Z        457 QYSTGQVSVEIEWELQKENSKRWNPEVQYT-SNYAKSANVDFT 498
Cdd:pfam00740 479 QYSTGQVTVKLEWELKRRASKRWNPEYQATvSNPSAGGWLPYA 521
 
Name Accession Description Interval E-value
Parvo_coat pfam00740
Parvovirus coat protein VP2; This protein, together with VP1 forms a capsomer. Both of these ...
1-498 0e+00

Parvovirus coat protein VP2; This protein, together with VP1 forms a capsomer. Both of these proteins are formed from the same transcript using alternative splicing. As a result, VP1 and VP2 differ only in the N-terminal region of VP1. VP2 is involved in packaging the viral DNA.


Pssm-ID: 250098  Cd Length: 521  Bit Score: 639.78  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z          1 GADGVGNASGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISS-ASTGASNDNHYFGYSTPWGYFDFNRFHCHFSPR 79
Cdd:pfam00740   1 GGGGVGNSTGGWHGGTTFSDNEVTTTSTRTWHLPMYNNHLYKRISVhNTSDTNADDPHMGISTPWSYFDFNAFGVHFSPR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z         80 DWQRLINNNWGFRPKRLNFKLFNIQVKEVTTNDGV-TTIANNLTSTVQVFSDSEYQLPYVLGSAHQGCLPPFPADVFMIP 158
Cdd:pfam00740  81 DWQRLINNYWGIRPKSLTVEIFNIVVKDVTTGDGAtTTVNNDLTATVQVFLDSNYQLPYVLGAGQEGTLPFLPWKVYKLP 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z        159 QYGYL--------TLNNGS---QAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYL 227
Cdd:pfam00740 161 QYGYYtvgdllsvTLDGNSttvNSTERSAFYTLENFPIQLLRTGDNFETTYEFPDVPFKLTHTWQQNLDLGMNPLVDQRL 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z        228 YYLNRTQNQSGSAQNKDLlFSRGSPAGMSVQPKNWLPGP---CYRQQRVSKTKTDNN-----NSNFTWTGASKYNLNGRE 299
Cdd:pfam00740 241 YVLTSLPGTGTGTATLRV-FRKLRKGDTAQQPKNWLPGPaqvMVPQQNFEASSGGPFkvpvvPSWNTRGTEQPTPGNDRE 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z        300 SIINPGTAMASHKDDKDKFFPMSGVMIFGKESAGASNTA---LDNVMITDEEEIKATNPVATERFGTVAVNLQSSSTDPA 376
Cdd:pfam00740 320 ANGAPRPTYGTQHGGGTASIALQERLTFDAKPEEAGRTTqqdFNQRLPTSEEEILPLNAVNVDTYGLLPTNPQGGKTDQN 399
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z        377 TGDVHVMGALPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPPaEFSATKFASFIT 456
Cdd:pfam00740 400 YTNVFNSYGPPGAVWNPRPIYYQGQIWDKIPNTDHKFHLHPLLGGVGLNNPPPQIFVKLTPNPTPPT-TFTDSGTDSRIN 478
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|...
1VU0_Z        457 QYSTGQVSVEIEWELQKENSKRWNPEVQYT-SNYAKSANVDFT 498
Cdd:pfam00740 479 QYSTGQVTVKLEWELKRRASKRWNPEYQATvSNPSAGGWLPYA 521
 
Name Accession Description Interval E-value
Parvo_coat pfam00740
Parvovirus coat protein VP2; This protein, together with VP1 forms a capsomer. Both of these ...
1-498 0e+00

Parvovirus coat protein VP2; This protein, together with VP1 forms a capsomer. Both of these proteins are formed from the same transcript using alternative splicing. As a result, VP1 and VP2 differ only in the N-terminal region of VP1. VP2 is involved in packaging the viral DNA.


Pssm-ID: 250098  Cd Length: 521  Bit Score: 639.78  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z          1 GADGVGNASGNWHCDSTWLGDRVITTSTRTWALPTYNNHLYKQISS-ASTGASNDNHYFGYSTPWGYFDFNRFHCHFSPR 79
Cdd:pfam00740   1 GGGGVGNSTGGWHGGTTFSDNEVTTTSTRTWHLPMYNNHLYKRISVhNTSDTNADDPHMGISTPWSYFDFNAFGVHFSPR 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z         80 DWQRLINNNWGFRPKRLNFKLFNIQVKEVTTNDGV-TTIANNLTSTVQVFSDSEYQLPYVLGSAHQGCLPPFPADVFMIP 158
Cdd:pfam00740  81 DWQRLINNYWGIRPKSLTVEIFNIVVKDVTTGDGAtTTVNNDLTATVQVFLDSNYQLPYVLGAGQEGTLPFLPWKVYKLP 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z        159 QYGYL--------TLNNGS---QAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEDVPFHSSYAHSQSLDRLMNPLIDQYL 227
Cdd:pfam00740 161 QYGYYtvgdllsvTLDGNSttvNSTERSAFYTLENFPIQLLRTGDNFETTYEFPDVPFKLTHTWQQNLDLGMNPLVDQRL 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z        228 YYLNRTQNQSGSAQNKDLlFSRGSPAGMSVQPKNWLPGP---CYRQQRVSKTKTDNN-----NSNFTWTGASKYNLNGRE 299
Cdd:pfam00740 241 YVLTSLPGTGTGTATLRV-FRKLRKGDTAQQPKNWLPGPaqvMVPQQNFEASSGGPFkvpvvPSWNTRGTEQPTPGNDRE 319
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z        300 SIINPGTAMASHKDDKDKFFPMSGVMIFGKESAGASNTA---LDNVMITDEEEIKATNPVATERFGTVAVNLQSSSTDPA 376
Cdd:pfam00740 320 ANGAPRPTYGTQHGGGTASIALQERLTFDAKPEEAGRTTqqdFNQRLPTSEEEILPLNAVNVDTYGLLPTNPQGGKTDQN 399
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VU0_Z        377 TGDVHVMGALPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKHPPPQILIKNTPVPANPPaEFSATKFASFIT 456
Cdd:pfam00740 400 YTNVFNSYGPPGAVWNPRPIYYQGQIWDKIPNTDHKFHLHPLLGGVGLNNPPPQIFVKLTPNPTPPT-TFTDSGTDSRIN 478
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|...
1VU0_Z        457 QYSTGQVSVEIEWELQKENSKRWNPEVQYT-SNYAKSANVDFT 498
Cdd:pfam00740 479 QYSTGQVTVKLEWELKRRASKRWNPEYQATvSNPSAGGWLPYA 521
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH