NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|335281697|ref|XP_003122670.2|]
View 

PREDICTED: metastasis-associated protein MTA2 isoform 1 [Sus scrofa]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
BAH_MTA cd04709
BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins. The ...
3-168 3.50e-92

BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins. The Metastasis-associated protein MTA1 is part of the NURD (nucleosome remodeling and deacetylating) complex and plays a role in cellular transformation and metastasis. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.


:

Pssm-ID: 240060  Cd Length: 164  Bit Score: 285.05  E-value: 3.50e-92
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 335281697   3 ANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISGSLNSLADSNAREFEEesKQPGVSEQQRHQ 82
Cdd:cd04709    1 ANMYRVGDYVYFESSPNNPYLIRRIEELNKTARGHVEAKVVCYYRRRDIPDSLYQLADQHRRELEE--KSDDLTPKQRHQ 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 335281697  83 LKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLA 162
Cdd:cd04709   79 LRHRELFLSRQVETLPATHIRGKCSVTLLNDTESARSYLAREDTFFYSLVYDPEQKTLLADQGEIRVGPSYQAKLPDLQP 158

                 ....*.
gi 335281697 163 EGESDN 168
Cdd:cd04709  159 FPSPDG 164
SANT_MTA3_like cd11661
Myb-Like Dna-Binding Domain of MTA3 and related proteins; Members in this SANT/myb family ...
267-312 1.56e-25

Myb-Like Dna-Binding Domain of MTA3 and related proteins; Members in this SANT/myb family include domains found in mouse metastasis-associated protein 3 (MTA3) proteins and arginine-glutamic dipeptide (RERE) repeats proteins. SANT (SWI3, ADA2, N-CoR and TFIIIB) DNA-binding domains are a diverse set of proteins that share a common 3 alpha-helix bundle. MTA3 has been shown to interact with nucleosome remodeling and deacetylase (NuRD) proteins CHD4 and HDAC1, and the core cohesin complex protein RAD21 in the ovary, and regulate G2/M progression in proliferating granulosa cells. RERE belongs to the atrophin family and has been identified as a nuclear receptor corepressor; altered expression levels of RERE are associated with cancer in humans while mutations of Rere in mice cause failure in closing the anterior neural tube and fusion of the telencephalic and optic vesicles during embryogenesis.


:

Pssm-ID: 212559  Cd Length: 46  Bit Score: 100.38  E-value: 1.56e-25
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*.
gi 335281697 267 EWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKT 312
Cdd:cd11661    1 EWSESEAKLFEEGLRKYGKDFHDIRQDFLPWKSVGELVEFYYMWKK 46
ZnF_GATA cd00202
Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] ...
366-421 5.96e-11

Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C


:

Pssm-ID: 238123 [Multi-domain]  Cd Length: 54  Bit Score: 58.92  E-value: 5.96e-11
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 335281697 366 TCESCHTTQSAQWYAWgpPNMQCRLCASCWIYWKKYgGLKTPTQLEGAARGTTEPH 421
Cdd:cd00202    1 ACSNCGTTTTPLWRRG--PSGGSTLCNACGLYWKKH-GVMRPLSKRKKDQIKRRNR 53
ELM2 pfam01448
ELM2 domain; The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown ...
147-201 4.81e-18

ELM2 domain; The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown function. It is found in the MTA1 protein that is part of the NuRD complex. The domain is usually found to the N terminus of a myb-like DNA binding domain pfam00249. ELM2 is also found associated with an ARID DNA binding domain pfam01388 in a member from Arabidopsis thaliana. This suggests that ELM2 may also be involved in DNA binding, or perhaps is a protein-protein interaction domain.


:

Pssm-ID: 250629  Cd Length: 55  Bit Score: 79.19  E-value: 4.81e-18
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 335281697  147 IRVGCKYQAEIPDRLAEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVG 201
Cdd:pfam01448   1 IRVGSDFQAEIPELLPESEKDQDKEEDEDELVWSPNNELSEQKLEEFLLVAKSRA 55
ZnF_GATA smart00401
zinc finger binding to DNA consensus sequence [AT]GATA[AG];
363-413 2.89e-16

zinc finger binding to DNA consensus sequence [AT]GATA[AG];


:

Pssm-ID: 214648 [Multi-domain]  Cd Length: 52  Bit Score: 73.99  E-value: 2.89e-16
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 335281697   363 KGLTCESCHTTQSAQWYAWGPPNmqCRLCASCWIYWKKYGGLKTPTQLEGA 413
Cdd:smart00401   2 SGRSCSNCGTTETPLWRRGPSGN--KTLCNACGLYYKKHGGLKRPLSLKKD 50
SANT smart00717
SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains;
266-313 6.43e-05

SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains;


:

Pssm-ID: 197842 [Multi-domain]  Cd Length: 49  Bit Score: 41.44  E-value: 6.43e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 335281697   266 EEWSASEAMLFEEALEKYG-KDFNDIRQdFLPWKSLASIVQFYYMWKTT 313
Cdd:smart00717   2 GEWTEEEDELLIELVKKYGkNNWEKIAK-ELPGRTAEQCRERWRNLLKP 49
 
Name Accession Description Interval E-value
BAH_MTA cd04709
BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins. The ...
3-168 3.50e-92

BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins. The Metastasis-associated protein MTA1 is part of the NURD (nucleosome remodeling and deacetylating) complex and plays a role in cellular transformation and metastasis. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.


Pssm-ID: 240060  Cd Length: 164  Bit Score: 285.05  E-value: 3.50e-92
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 335281697   3 ANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISGSLNSLADSNAREFEEesKQPGVSEQQRHQ 82
Cdd:cd04709    1 ANMYRVGDYVYFESSPNNPYLIRRIEELNKTARGHVEAKVVCYYRRRDIPDSLYQLADQHRRELEE--KSDDLTPKQRHQ 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 335281697  83 LKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLA 162
Cdd:cd04709   79 LRHRELFLSRQVETLPATHIRGKCSVTLLNDTESARSYLAREDTFFYSLVYDPEQKTLLADQGEIRVGPSYQAKLPDLQP 158

                 ....*.
gi 335281697 163 EGESDN 168
Cdd:cd04709  159 FPSPDG 164
SANT_MTA3_like cd11661
Myb-Like Dna-Binding Domain of MTA3 and related proteins; Members in this SANT/myb family ...
267-312 1.56e-25

Myb-Like Dna-Binding Domain of MTA3 and related proteins; Members in this SANT/myb family include domains found in mouse metastasis-associated protein 3 (MTA3) proteins and arginine-glutamic dipeptide (RERE) repeats proteins. SANT (SWI3, ADA2, N-CoR and TFIIIB) DNA-binding domains are a diverse set of proteins that share a common 3 alpha-helix bundle. MTA3 has been shown to interact with nucleosome remodeling and deacetylase (NuRD) proteins CHD4 and HDAC1, and the core cohesin complex protein RAD21 in the ovary, and regulate G2/M progression in proliferating granulosa cells. RERE belongs to the atrophin family and has been identified as a nuclear receptor corepressor; altered expression levels of RERE are associated with cancer in humans while mutations of Rere in mice cause failure in closing the anterior neural tube and fusion of the telencephalic and optic vesicles during embryogenesis.


Pssm-ID: 212559  Cd Length: 46  Bit Score: 100.38  E-value: 1.56e-25
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*.
gi 335281697 267 EWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKT 312
Cdd:cd11661    1 EWSESEAKLFEEGLRKYGKDFHDIRQDFLPWKSVGELVEFYYMWKK 46
ZnF_GATA cd00202
Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] ...
366-421 5.96e-11

Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C


Pssm-ID: 238123 [Multi-domain]  Cd Length: 54  Bit Score: 58.92  E-value: 5.96e-11
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 335281697 366 TCESCHTTQSAQWYAWgpPNMQCRLCASCWIYWKKYgGLKTPTQLEGAARGTTEPH 421
Cdd:cd00202    1 ACSNCGTTTTPLWRRG--PSGGSTLCNACGLYWKKH-GVMRPLSKRKKDQIKRRNR 53
BAH smart00439
Bromo adjacent homology domain;
5-140 1.81e-21

Bromo adjacent homology domain;


Pssm-ID: 214664  Cd Length: 121  Bit Score: 90.81  E-value: 1.81e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 335281697     5 MYRVGDYVYFENSSSN-PYLVRRIEELNKTANGN--VEAKVVCLFRRRDISGSLNSLADSNarefeeeskqpgvseqqrh 81
Cdd:smart00439   1 TISVGDFVLVEPDDADePYYIGRIEEIFETKKNSesKMVRVRWFYRPEETVLEKAALFDKN------------------- 61
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 335281697    82 qlkhrELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEK--EDCFFYSLVFDPVQKTL 140
Cdd:smart00439  62 -----EVFLSDEYDTVPLSDIIGKCNVLYKSDYPGLRPEGSIgePDVFFCESAYDPEKGSF 117
BAH pfam01426
BAH domain; This domain has been called BAH (Bromo adjacent homology) domain and has also been ...
4-143 1.12e-19

BAH domain; This domain has been called BAH (Bromo adjacent homology) domain and has also been called ELM1 and BAM (Bromo adjacent motif) domain. The function of this domain is unknown but may be involved in protein-protein interaction.


Pssm-ID: 250611  Cd Length: 120  Bit Score: 85.86  E-value: 1.12e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 335281697    4 NMYRVGDYVYFEN-SSSNPYLVRRIEELNKTANGNVEAKVVCLFRR-RDISGSLNSLADsnarefeeeskqpgvseqqrh 81
Cdd:pfam01426   1 ETYSVGDFVLVEPdDAGEPPYVGRIEEIFEDSDGSKKMVHVRWFYRpEETVHRLGNAFN--------------------- 59
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 335281697   82 qlkHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEK-EDCFFYSLVFDPVQKTLLAD 143
Cdd:pfam01426  60 ---KDEVFLSDECDDVPLSDIIGKCNVLIKSDPESLQPRKIGgPDVFFCELLYDPERGSFKKL 119
ELM2 pfam01448
ELM2 domain; The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown ...
147-201 4.81e-18

ELM2 domain; The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown function. It is found in the MTA1 protein that is part of the NuRD complex. The domain is usually found to the N terminus of a myb-like DNA binding domain pfam00249. ELM2 is also found associated with an ARID DNA binding domain pfam01388 in a member from Arabidopsis thaliana. This suggests that ELM2 may also be involved in DNA binding, or perhaps is a protein-protein interaction domain.


Pssm-ID: 250629  Cd Length: 55  Bit Score: 79.19  E-value: 4.81e-18
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 335281697  147 IRVGCKYQAEIPDRLAEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVG 201
Cdd:pfam01448   1 IRVGSDFQAEIPELLPESEKDQDKEEDEDELVWSPNNELSEQKLEEFLLVAKSRA 55
GATA pfam00320
GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This ...
367-404 1.83e-10

GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain.


Pssm-ID: 249767  Cd Length: 36  Bit Score: 57.28  E-value: 1.83e-10
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 335281697  367 CESCHTTQSAQWYAWgpPNMQCRLCASCWIYWKKYGGL 404
Cdd:pfam00320   1 CSNCGTTKTPLWRRG--PDGNRTLCNACGLYYKKHGLK 36
Myb_DNA-binding pfam00249
Myb-like DNA-binding domain; This family contains the DNA binding domains from Myb proteins, ...
267-311 1.39e-03

Myb-like DNA-binding domain; This family contains the DNA binding domains from Myb proteins, as well as the SANT domain family.


Pssm-ID: 249715  Cd Length: 47  Bit Score: 37.12  E-value: 1.39e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 335281697  267 EWSASEAMLFEEALEKYG-KDFNDIrQDFLPWKSLASIVQFYYMWK 311
Cdd:pfam00249   3 PWTPEEDELLIEAVKKHGnGNWKKI-AKHLPGRTDNQCKNRWNNYL 47
ZnF_GATA smart00401
zinc finger binding to DNA consensus sequence [AT]GATA[AG];
363-413 2.89e-16

zinc finger binding to DNA consensus sequence [AT]GATA[AG];


Pssm-ID: 214648 [Multi-domain]  Cd Length: 52  Bit Score: 73.99  E-value: 2.89e-16
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 335281697   363 KGLTCESCHTTQSAQWYAWGPPNmqCRLCASCWIYWKKYGGLKTPTQLEGA 413
Cdd:smart00401   2 SGRSCSNCGTTETPLWRRGPSGN--KTLCNACGLYYKKHGGLKRPLSLKKD 50
SANT smart00717
SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains;
266-313 6.43e-05

SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains;


Pssm-ID: 197842 [Multi-domain]  Cd Length: 49  Bit Score: 41.44  E-value: 6.43e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 335281697   266 EEWSASEAMLFEEALEKYG-KDFNDIRQdFLPWKSLASIVQFYYMWKTT 313
Cdd:smart00717   2 GEWTEEEDELLIELVKKYGkNNWEKIAK-ELPGRTAEQCRERWRNLLKP 49
 
Name Accession Description Interval E-value
BAH_MTA cd04709
BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins. The ...
3-168 3.50e-92

BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins. The Metastasis-associated protein MTA1 is part of the NURD (nucleosome remodeling and deacetylating) complex and plays a role in cellular transformation and metastasis. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.


Pssm-ID: 240060  Cd Length: 164  Bit Score: 285.05  E-value: 3.50e-92
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 335281697   3 ANMYRVGDYVYFENSSSNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISGSLNSLADSNAREFEEesKQPGVSEQQRHQ 82
Cdd:cd04709    1 ANMYRVGDYVYFESSPNNPYLIRRIEELNKTARGHVEAKVVCYYRRRDIPDSLYQLADQHRRELEE--KSDDLTPKQRHQ 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 335281697  83 LKHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDPVQKTLLADQGEIRVGCKYQAEIPDRLA 162
Cdd:cd04709   79 LRHRELFLSRQVETLPATHIRGKCSVTLLNDTESARSYLAREDTFFYSLVYDPEQKTLLADQGEIRVGPSYQAKLPDLQP 158

                 ....*.
gi 335281697 163 EGESDN 168
Cdd:cd04709  159 FPSPDG 164
SANT_MTA3_like cd11661
Myb-Like Dna-Binding Domain of MTA3 and related proteins; Members in this SANT/myb family ...
267-312 1.56e-25

Myb-Like Dna-Binding Domain of MTA3 and related proteins; Members in this SANT/myb family include domains found in mouse metastasis-associated protein 3 (MTA3) proteins and arginine-glutamic dipeptide (RERE) repeats proteins. SANT (SWI3, ADA2, N-CoR and TFIIIB) DNA-binding domains are a diverse set of proteins that share a common 3 alpha-helix bundle. MTA3 has been shown to interact with nucleosome remodeling and deacetylase (NuRD) proteins CHD4 and HDAC1, and the core cohesin complex protein RAD21 in the ovary, and regulate G2/M progression in proliferating granulosa cells. RERE belongs to the atrophin family and has been identified as a nuclear receptor corepressor; altered expression levels of RERE are associated with cancer in humans while mutations of Rere in mice cause failure in closing the anterior neural tube and fusion of the telencephalic and optic vesicles during embryogenesis.


Pssm-ID: 212559  Cd Length: 46  Bit Score: 100.38  E-value: 1.56e-25
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*.
gi 335281697 267 EWSASEAMLFEEALEKYGKDFNDIRQDFLPWKSLASIVQFYYMWKT 312
Cdd:cd11661    1 EWSESEAKLFEEGLRKYGKDFHDIRQDFLPWKSVGELVEFYYMWKK 46
ZnF_GATA cd00202
Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] ...
366-421 5.96e-11

Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C


Pssm-ID: 238123 [Multi-domain]  Cd Length: 54  Bit Score: 58.92  E-value: 5.96e-11
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 335281697 366 TCESCHTTQSAQWYAWgpPNMQCRLCASCWIYWKKYgGLKTPTQLEGAARGTTEPH 421
Cdd:cd00202    1 ACSNCGTTTTPLWRRG--PSGGSTLCNACGLYWKKH-GVMRPLSKRKKDQIKRRNR 53
BAH cd04370
BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif). ...
3-140 2.57e-22

BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif). BAH domains have first been described as domains found in the polybromo protein and Yeast Rsc1/Rsc2 (Remodeling of the Structure of Chromatin). They also occur in mammalian DNA methyltransferases and the MTA1 subunits of histone deacetylase complexes. A BAH domain is also found in Yeast Sir3p and in the origin receptor complex protein 1 (Orc1p), where it was found to interact with the N-terminal lobe of the silence information regulator 1 protein (Sir1p), confirming the initial hypothesis that BAH plays a role in protein-protein interactions.


Pssm-ID: 239835  Cd Length: 123  Bit Score: 93.23  E-value: 2.57e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 335281697   3 ANMYRVGDYVYFENSS---SNPYLVRRIEELNKTANGNVEAKVVCLFRRRDISGSLNSLADSnarefeeeskqpgvseqq 79
Cdd:cd04370    1 GITYEVGDSVYVEPDDsikSDPPYIARIEELWEDTNGSKQVKVRWFYRPEETPKGLSPFALR------------------ 62
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 335281697  80 rhqlkhRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEK--EDCFFYSLVFDPVQKTL 140
Cdd:cd04370   63 ------RELFLSDHLDEIPVESIIGKCKVLFVSEFEGLKQRPNKidTDDFFCRLAYDPTTKEF 119
BAH smart00439
Bromo adjacent homology domain;
5-140 1.81e-21

Bromo adjacent homology domain;


Pssm-ID: 214664  Cd Length: 121  Bit Score: 90.81  E-value: 1.81e-21
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 335281697     5 MYRVGDYVYFENSSSN-PYLVRRIEELNKTANGN--VEAKVVCLFRRRDISGSLNSLADSNarefeeeskqpgvseqqrh 81
Cdd:smart00439   1 TISVGDFVLVEPDDADePYYIGRIEEIFETKKNSesKMVRVRWFYRPEETVLEKAALFDKN------------------- 61
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 335281697    82 qlkhrELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEK--EDCFFYSLVFDPVQKTL 140
Cdd:smart00439  62 -----EVFLSDEYDTVPLSDIIGKCNVLYKSDYPGLRPEGSIgePDVFFCESAYDPEKGSF 117
BAH pfam01426
BAH domain; This domain has been called BAH (Bromo adjacent homology) domain and has also been ...
4-143 1.12e-19

BAH domain; This domain has been called BAH (Bromo adjacent homology) domain and has also been called ELM1 and BAM (Bromo adjacent motif) domain. The function of this domain is unknown but may be involved in protein-protein interaction.


Pssm-ID: 250611  Cd Length: 120  Bit Score: 85.86  E-value: 1.12e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 335281697    4 NMYRVGDYVYFEN-SSSNPYLVRRIEELNKTANGNVEAKVVCLFRR-RDISGSLNSLADsnarefeeeskqpgvseqqrh 81
Cdd:pfam01426   1 ETYSVGDFVLVEPdDAGEPPYVGRIEEIFEDSDGSKKMVHVRWFYRpEETVHRLGNAFN--------------------- 59
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 335281697   82 qlkHRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEK-EDCFFYSLVFDPVQKTLLAD 143
Cdd:pfam01426  60 ---KDEVFLSDECDDVPLSDIIGKCNVLIKSDPESLQPRKIGgPDVFFCELLYDPERGSFKKL 119
ELM2 pfam01448
ELM2 domain; The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown ...
147-201 4.81e-18

ELM2 domain; The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown function. It is found in the MTA1 protein that is part of the NuRD complex. The domain is usually found to the N terminus of a myb-like DNA binding domain pfam00249. ELM2 is also found associated with an ARID DNA binding domain pfam01388 in a member from Arabidopsis thaliana. This suggests that ELM2 may also be involved in DNA binding, or perhaps is a protein-protein interaction domain.


Pssm-ID: 250629  Cd Length: 55  Bit Score: 79.19  E-value: 4.81e-18
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 335281697  147 IRVGCKYQAEIPDRLAEGESDNRNQQKMEMKVWDPDNPLTDRQIDQFLVVARAVG 201
Cdd:pfam01448   1 IRVGSDFQAEIPELLPESEKDQDKEEDEDELVWSPNNELSEQKLEEFLLVAKSRA 55
GATA pfam00320
GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This ...
367-404 1.83e-10

GATA zinc finger; This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain.


Pssm-ID: 249767  Cd Length: 36  Bit Score: 57.28  E-value: 1.83e-10
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 335281697  367 CESCHTTQSAQWYAWgpPNMQCRLCASCWIYWKKYGGL 404
Cdd:pfam00320   1 CSNCGTTKTPLWRRG--PDGNRTLCNACGLYYKKHGLK 36
BAH_fungalPHD cd04710
BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains. ...
5-135 1.02e-06

BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.


Pssm-ID: 240061  Cd Length: 135  Bit Score: 47.75  E-value: 1.02e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 335281697   5 MYRVGDYVYFENS-SSNPYLVRRIEE-LNKTANGNVEAKVVC-----------LFRRRDISgsLNSLADSnarefeeesk 71
Cdd:cd04710   11 LLKVNDHIYMSSEpPGEPYYIGRIMEfVPKHEFPSGIHARVFpasyfqvrlnwYYRPRDIS--RRVVADS---------- 78
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 335281697  72 qpgvseqqrhqlkhRELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEKEDCFFYSLVFDP 135
Cdd:cd04710   79 --------------RLLYASMHSDICPIGSVRGKCTVRHRDQIPDLEEYKKRPNHFYFDQLFDR 128
SANT cd00167
'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains. Tandem copies of the domain bind telomeric ...
267-311 5.59e-05

'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains. Tandem copies of the domain bind telomeric DNA tandem repeatsas part of the capping complex. Binding is sequence dependent for repeats which contain the G/C rich motif [C2-3 A (CA)1-6]. The domain is also found in regulatory transcriptional repressor complexes where it also binds DNA.


Pssm-ID: 238096 [Multi-domain]  Cd Length: 45  Bit Score: 41.41  E-value: 5.59e-05
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*.
gi 335281697 267 EWSASEAMLFEEALEKYG-KDFNDIRQdFLPWKSLASIVQFYYMWK 311
Cdd:cd00167    1 PWTEEEDELLLEAVKKYGkNNWEKIAK-ELPGRTPKQCRERWRNLL 45
BAH_BAHCC1 cd04714
BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins. ...
7-135 7.28e-04

BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins. BAHCC1 stands for BAH domain and coiled-coil containing 1. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.


Pssm-ID: 240065  Cd Length: 121  Bit Score: 38.54  E-value: 7.28e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 335281697   7 RVGDYVYFENSSSN--PYlVRRIEELNKTANGNVEAKVVCLFRrrdisgslnsladsnarefEEESKQpgvSEQQRHQLK 84
Cdd:cd04714    5 RVGDCVLFKSPGRPslPY-VARIESLWEDPEGNMVVRVKWYYR-------------------PEETKG---GRKPNHGEK 61
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 335281697  85 hrELFLSRQFESLPATHIRGKCSVTLLNETDILSQYLEK----EDCFFYSLVFDP 135
Cdd:cd04714   62 --ELFASDHQDENSVQTIEHKCYVLTFAEYERLARVKKKpqdgVDFYYCAGTYNP 114
Myb_DNA-binding pfam00249
Myb-like DNA-binding domain; This family contains the DNA binding domains from Myb proteins, ...
267-311 1.39e-03

Myb-like DNA-binding domain; This family contains the DNA binding domains from Myb proteins, as well as the SANT domain family.


Pssm-ID: 249715  Cd Length: 47  Bit Score: 37.12  E-value: 1.39e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*.
gi 335281697  267 EWSASEAMLFEEALEKYG-KDFNDIrQDFLPWKSLASIVQFYYMWK 311
Cdd:pfam00249   3 PWTPEEDELLIEAVKKHGnGNWKKI-AKHLPGRTDNQCKNRWNNYL 47
ZnF_GATA smart00401
zinc finger binding to DNA consensus sequence [AT]GATA[AG];
363-413 2.89e-16

zinc finger binding to DNA consensus sequence [AT]GATA[AG];


Pssm-ID: 214648 [Multi-domain]  Cd Length: 52  Bit Score: 73.99  E-value: 2.89e-16
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|.
gi 335281697   363 KGLTCESCHTTQSAQWYAWGPPNmqCRLCASCWIYWKKYGGLKTPTQLEGA 413
Cdd:smart00401   2 SGRSCSNCGTTETPLWRRGPSGN--KTLCNACGLYYKKHGGLKRPLSLKKD 50
SANT smart00717
SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains;
266-313 6.43e-05

SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains;


Pssm-ID: 197842 [Multi-domain]  Cd Length: 49  Bit Score: 41.44  E-value: 6.43e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 335281697   266 EEWSASEAMLFEEALEKYG-KDFNDIRQdFLPWKSLASIVQFYYMWKTT 313
Cdd:smart00717   2 GEWTEEEDELLIELVKKYGkNNWEKIAK-ELPGRTAEQCRERWRNLLKP 49
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH