NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|320544311|ref|NP_611747|]
View 

CG42741 [Drosophila melanogaster]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
zf-H2C2_2 pfam13465
Zinc-finger double domain;
326-351 2.16e-05

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 41.23  E-value: 2.16e-05
                          10        20
                  ....*....|....*....|....*.
gi 320544311  326 ELTRHYRKHTGVKPFRCQLCTRSFSR 351
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
296-313 4.32e-03

Zinc-finger double domain;


:

Pssm-ID: 257789  Cd Length: 26  Bit Score: 34.68  E-value: 4.32e-03
                          10
                  ....*....|....*...
gi 320544311  296 HLKAHKRTHTGEKPYVCT 313
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCP 18
COG5048 COG5048
FOG: Zn-finger [General function prediction only]
273-352 2.00e-04

FOG: Zn-finger [General function prediction only]


:

Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 41.61  E-value: 2.00e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320544311 273 LSKNRKVHKCDTEGCDKVYTKSSHLKAHKRT--HTGE--KPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRS 348
Cdd:COG5048  281 SSEKGFSLPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSS 360

                 ....
gi 320544311 349 FSRS 352
Cdd:COG5048  361 SKFS 364
 
Name Accession Description Interval E-value
zf-H2C2_2 pfam13465
Zinc-finger double domain;
326-351 2.16e-05

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 41.23  E-value: 2.16e-05
                          10        20
                  ....*....|....*....|....*.
gi 320544311  326 ELTRHYRKHTGVKPFRCQLCTRSFSR 351
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSFSS 26
zf-H2C2_2 pfam13465
Zinc-finger double domain;
296-313 4.32e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 34.68  E-value: 4.32e-03
                          10
                  ....*....|....*...
gi 320544311  296 HLKAHKRTHTGEKPYVCT 313
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCP 18
ZnF_C2H2 smart00355
zinc finger;
340-362 7.87e-03

zinc finger;


Pssm-ID: 197676  Cd Length: 23  Bit Score: 33.98  E-value: 7.87e-03
                           10        20
                   ....*....|....*....|...
gi 320544311   340 FRCQLCTRSFSRSDHLSLHMRRH 362
Cdd:smart00355   1 YRCPECGKVFKSKSALREHMRTH 23
COG5048 COG5048
FOG: Zn-finger [General function prediction only]
273-352 2.00e-04

FOG: Zn-finger [General function prediction only]


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 41.61  E-value: 2.00e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320544311 273 LSKNRKVHKCDTEGCDKVYTKSSHLKAHKRT--HTGE--KPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRS 348
Cdd:COG5048  281 SSEKGFSLPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSS 360

                 ....
gi 320544311 349 FSRS 352
Cdd:COG5048  361 SKFS 364
 
Name Accession Description Interval E-value
zf-H2C2_2 pfam13465
Zinc-finger double domain;
326-351 2.16e-05

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 41.23  E-value: 2.16e-05
                          10        20
                  ....*....|....*....|....*.
gi 320544311  326 ELTRHYRKHTGVKPFRCQLCTRSFSR 351
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCPECGKSFSS 26
zf-C2H2 pfam00096
Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two ...
340-362 3.44e-03

Zinc finger, C2H2 type; The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter.


Pssm-ID: 249585  Cd Length: 23  Bit Score: 34.99  E-value: 3.44e-03
                          10        20
                  ....*....|....*....|...
gi 320544311  340 FRCQLCTRSFSRSDHLSLHMRRH 362
Cdd:pfam00096   1 YKCPDCGKSFSRKSNLKRHLRTH 23
zf-H2C2_2 pfam13465
Zinc-finger double domain;
296-313 4.32e-03

Zinc-finger double domain;


Pssm-ID: 257789  Cd Length: 26  Bit Score: 34.68  E-value: 4.32e-03
                          10
                  ....*....|....*...
gi 320544311  296 HLKAHKRTHTGEKPYVCT 313
Cdd:pfam13465   1 NLRRHMRTHTGEKPYKCP 18
ZnF_C2H2 smart00355
zinc finger;
340-362 7.87e-03

zinc finger;


Pssm-ID: 197676  Cd Length: 23  Bit Score: 33.98  E-value: 7.87e-03
                           10        20
                   ....*....|....*....|...
gi 320544311   340 FRCQLCTRSFSRSDHLSLHMRRH 362
Cdd:smart00355   1 YRCPECGKVFKSKSALREHMRTH 23
zf-C2H2_4 pfam13894
C2H2-type zinc finger; This family contains a number of divergent C2H2 type zinc fingers.
340-362 8.11e-03

C2H2-type zinc finger; This family contains a number of divergent C2H2 type zinc fingers.


Pssm-ID: 258161  Cd Length: 24  Bit Score: 33.76  E-value: 8.11e-03
                          10        20
                  ....*....|....*....|...
gi 320544311  340 FRCQLCTRSFSRSDHLSLHMRRH 362
Cdd:pfam13894   1 FRCPLCGKSFSSKDALKRHLRKH 23
COG5048 COG5048
FOG: Zn-finger [General function prediction only]
273-352 2.00e-04

FOG: Zn-finger [General function prediction only]


Pssm-ID: 227381 [Multi-domain]  Cd Length: 467  Bit Score: 41.61  E-value: 2.00e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320544311 273 LSKNRKVHKCDTEGCDKVYTKSSHLKAHKRT--HTGE--KPYVCTWEGCIWRFARSDELTRHYRKHTGVKPFRCQLCTRS 348
Cdd:COG5048  281 SSEKGFSLPIKSKQCNISFSRSSPLTRHLRSvnHSGEslKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSS 360

                 ....
gi 320544311 349 FSRS 352
Cdd:COG5048  361 SKFS 364
SFP1 COG5189
Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division ...
269-362 2.19e-04

Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]


Pssm-ID: 227516 [Multi-domain]  Cd Length: 423  Bit Score: 41.63  E-value: 2.19e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320544311 269 GYNDLSKNRKVHKCDTEGCDKVYTKSSHLKAHKRT-HTGEKPYVCTWEGCIWRFARSDeltrhyrkhtgvKPFRCQLCTR 347
Cdd:COG5189  339 SRMLKVKDGKPYKCPVEGCNKKYKNQNGLKYHMLHgHQNQKLHENPSPEKMNIFSAKD------------KPYRCEVCDK 406
                         90
                 ....*....|....*
gi 320544311 348 SFSRSDHLSLHmRRH 362
Cdd:COG5189  407 RYKNLNGLKYH-RKH 420
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH