NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|320542214|ref|NP_001188644|]
View 

paralytic, isoform AW [Drosophila melanogaster]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1492-1544 4.51e-28

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


:

Pssm-ID: 240441  Cd Length: 54  Bit Score: 110.35  E-value: 4.51e-28
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 320542214 1492 DNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVF 1544
Cdd:cd13433     1 DNFNQLKKKYGGGLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIF 53
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
998-1242 3.64e-69

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


:

Pssm-ID: 253777  Cd Length: 230  Bit Score: 234.97  E-value: 3.64e-69
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   998 DNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPsgkgvcrcisaEHGDNELELGHDEILADGLIKKGIK 1077
Cdd:pfam06512    1 DGEMNNLQIAIARIQRGINWVKRNIRDFFKKLLKKKPKEIDEQT-----------EAEDNLLDKAVDDILSNHYLKEGNG 69
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1078 eqtQLEVAIGDGMEFTIHGDMKNNKPKkSKYLNNAT-----------------DDDTASINSYGshknrpFKDESHKGSA 1140
Cdd:pfam06512   70 ---TTSVAIGDGMEKTIHGDVKESDPM-SFITNPSLtvsvpiasgesdlenlnDEDTSSESSYG------FKEESKKGSA 139
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1141 ETMEGEEKrDASKEDLGLDEELDeegeceegPLDGDIIIHAHDEDILDeyPADCCPDSYYKKFPILAGDDDSPFWQGWGN 1220
Cdd:pfam06512  140 ETLKLEEK-DSSSSEGSTVDLEP--------PEEEEEEIAEEEEEVKE--PEDCFPEGCVRRFPCCAVDIDSGFGKGWWN 208
                          250       260
                   ....*....|....*....|..
gi 320542214  1221 LRLKTFQLIENKYFETAVITMI 1242
Cdd:pfam06512  209 LRKTCYQIVEHSWFETFIIFMI 230
DUF3451 pfam11933
Domain of unknown function (DUF3451); This presumed domain is functionally uncharacterized. ...
483-673 4.88e-45

Domain of unknown function (DUF3451); This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 199 to 238 amino acids in length. This domain is found associated with pfam06512, pfam00520. This domain has a conserved ADD sequence motif.


:

Pssm-ID: 256738  Cd Length: 222  Bit Score: 164.97  E-value: 4.88e-45
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   483 PTYSCISYELFVGGEKGNDDNNKEKMSIRSVEVESES------------------------------------------- 519
Cdd:pfam11933    1 SDYSKLSSESAKERRNRNDKNKKEEHSIGSEEGDSEKepksesadgrkrcrfllrktrkvsqsllslpgspfntrrgsrg 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   520 --YTIRnGRGRFgiPGSDRkplvlstyqdaqqhlPYADDSNAVTPMSEENGAIIVPVYYgNLGSRHSSYTSHQSRIS--Y 595
Cdd:pfam11933   81 siFSFR-GRGRD--VGSEN---------------DFADDENSVTEMSESRGSLFLPWRY-ERRSSHSSYTSHSSRIFpkL 141
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   596 TSHGDLLGGMAVMGVSTMTKESKLRNrNTRNQSVGATN--GGTTCLDTNHKLDHRDYEIGLECTDEAGKIKHHDNPFIEP 673
Cdd:pfam11933  142 TSNGKLLGTVDCNGVVSLTGEDVLRA-SPGGNLLPECTmeKEGGTTDTEGKTHLRSLELSVDLLEEPVPGARRDRALSEV 220
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1268-1490 1.67e-55

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


:

Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 194.04  E-value: 1.67e-55
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1268 YMDRIFTVIFFLEMLIKWLALGFKV-YFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQG 1346
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGFKLsYFRSPWNILDFLVVLPSLVSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRFPG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1347 MRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDmngtklsheiipnrnacesENYTWVNSAMNFDHV 1426
Cdd:pfam00520   81 LRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCED-------------------ENENPINGNSNFDSY 141
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 320542214  1427 GNAYLCLFQVATFKGWIQIMNDAIDsrevdkqpirETNIYMYLYFVFFIIFGSFFTLNLFIGVI 1490
Cdd:pfam00520  142 PEALLWLFRTLTTEGWGDIMPDTLD----------AGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1584-1790 8.32e-44

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


:

Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 160.53  E-value: 8.32e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1584 YLNAIFVVIFSSECLLKIFALR--YHYFIEPWNLFDVVVVILSILGLVLSdiiEKYFVSPTLLRVVRVAKVGRVLRLVKG 1661
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGfkLSYFRSPWNILDFLVVLPSLVSLILR---LLGEGSEGLLSVLRLLRLLRLLRLLRR 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1662 AKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKS------GINDVYNFKTFGQSMILLFQMSTSAGW 1735
Cdd:pfam00520   78 FPGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCedenenPINGNSNFDSYPEALLWLFRTLTTEGW 157
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 320542214  1736 DGVLdaiineeacdppdndkgYPGNCGSATVGITFLLSYLVISFLIVINMYIAVI 1790
Cdd:pfam00520  158 GDIM-----------------PDTLDAGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
171-417 1.53e-41

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


:

Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 153.98  E-value: 1.53e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   171 EVIFTGIYTFESAVKVMARGFIlcpFTYLRDAWNWLDFVVIALAYVTMGIDL------GNLAALRTFRVLRALKTVAIVP 244
Cdd:pfam00520    3 DYVFTVIFTLEMLLKFIALGFK---LSYFRSPWNILDFLVVLPSLVSLILRLlgegseGLLSVLRLLRLLRLLRLLRRFP 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   245 GLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFpldgswgnltdenwdyhnrnssnwysedeg 324
Cdd:pfam00520   80 GLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEDENE------------------------------ 129
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   325 isfplcgnisgagqcdddyvclqgfgpNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFL 404
Cdd:pfam00520  130 ---------------------------NPINGNSNFDSYPEALLWLFRTLTTEGWGDIMPDTLDAGTVLGKIFFVIFIIL 182
                          250
                   ....*....|...
gi 320542214   405 GSFYLVNLILAIV 417
Cdd:pfam00520  183 GGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
798-972 4.74e-39

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


:

Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 146.66  E-value: 4.74e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   798 NYFFTATFAIEATMKLMAMSPKY-YFQEGWNIFDFIIV-----ALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLN 871
Cdd:pfam00520    3 DYVFTVIFTLEMLLKFIALGFKLsYFRSPWNILDFLVVlpslvSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRFPGLR 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   872 LLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE-WIESMW 950
Cdd:pfam00520   83 TLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEDENENPINGNSNFDSYPEALLWLFRTLTTEgWGDIMP 162
                          170       180
                   ....*....|....*....|..
gi 320542214   951 DCMYVGDVSCIPFFLATVVIGN 972
Cdd:pfam00520  163 DTLDAGTVLGKIFFVIFIILGG 184
 
Name Accession Description Interval E-value
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1492-1544 4.51e-28

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 110.35  E-value: 4.51e-28
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 320542214 1492 DNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVF 1544
Cdd:cd13433     1 DNFNQLKKKYGGGLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIF 53
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
998-1242 3.64e-69

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 253777  Cd Length: 230  Bit Score: 234.97  E-value: 3.64e-69
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   998 DNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPsgkgvcrcisaEHGDNELELGHDEILADGLIKKGIK 1077
Cdd:pfam06512    1 DGEMNNLQIAIARIQRGINWVKRNIRDFFKKLLKKKPKEIDEQT-----------EAEDNLLDKAVDDILSNHYLKEGNG 69
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1078 eqtQLEVAIGDGMEFTIHGDMKNNKPKkSKYLNNAT-----------------DDDTASINSYGshknrpFKDESHKGSA 1140
Cdd:pfam06512   70 ---TTSVAIGDGMEKTIHGDVKESDPM-SFITNPSLtvsvpiasgesdlenlnDEDTSSESSYG------FKEESKKGSA 139
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1141 ETMEGEEKrDASKEDLGLDEELDeegeceegPLDGDIIIHAHDEDILDeyPADCCPDSYYKKFPILAGDDDSPFWQGWGN 1220
Cdd:pfam06512  140 ETLKLEEK-DSSSSEGSTVDLEP--------PEEEEEEIAEEEEEVKE--PEDCFPEGCVRRFPCCAVDIDSGFGKGWWN 208
                          250       260
                   ....*....|....*....|..
gi 320542214  1221 LRLKTFQLIENKYFETAVITMI 1242
Cdd:pfam06512  209 LRKTCYQIVEHSWFETFIIFMI 230
DUF3451 pfam11933
Domain of unknown function (DUF3451); This presumed domain is functionally uncharacterized. ...
483-673 4.88e-45

Domain of unknown function (DUF3451); This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 199 to 238 amino acids in length. This domain is found associated with pfam06512, pfam00520. This domain has a conserved ADD sequence motif.


Pssm-ID: 256738  Cd Length: 222  Bit Score: 164.97  E-value: 4.88e-45
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   483 PTYSCISYELFVGGEKGNDDNNKEKMSIRSVEVESES------------------------------------------- 519
Cdd:pfam11933    1 SDYSKLSSESAKERRNRNDKNKKEEHSIGSEEGDSEKepksesadgrkrcrfllrktrkvsqsllslpgspfntrrgsrg 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   520 --YTIRnGRGRFgiPGSDRkplvlstyqdaqqhlPYADDSNAVTPMSEENGAIIVPVYYgNLGSRHSSYTSHQSRIS--Y 595
Cdd:pfam11933   81 siFSFR-GRGRD--VGSEN---------------DFADDENSVTEMSESRGSLFLPWRY-ERRSSHSSYTSHSSRIFpkL 141
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   596 TSHGDLLGGMAVMGVSTMTKESKLRNrNTRNQSVGATN--GGTTCLDTNHKLDHRDYEIGLECTDEAGKIKHHDNPFIEP 673
Cdd:pfam11933  142 TSNGKLLGTVDCNGVVSLTGEDVLRA-SPGGNLLPECTmeKEGGTTDTEGKTHLRSLELSVDLLEEPVPGARRDRALSEV 220
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1268-1490 1.67e-55

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 194.04  E-value: 1.67e-55
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1268 YMDRIFTVIFFLEMLIKWLALGFKV-YFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQG 1346
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGFKLsYFRSPWNILDFLVVLPSLVSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRFPG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1347 MRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDmngtklsheiipnrnacesENYTWVNSAMNFDHV 1426
Cdd:pfam00520   81 LRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCED-------------------ENENPINGNSNFDSY 141
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 320542214  1427 GNAYLCLFQVATFKGWIQIMNDAIDsrevdkqpirETNIYMYLYFVFFIIFGSFFTLNLFIGVI 1490
Cdd:pfam00520  142 PEALLWLFRTLTTEGWGDIMPDTLD----------AGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1584-1790 8.32e-44

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 160.53  E-value: 8.32e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1584 YLNAIFVVIFSSECLLKIFALR--YHYFIEPWNLFDVVVVILSILGLVLSdiiEKYFVSPTLLRVVRVAKVGRVLRLVKG 1661
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGfkLSYFRSPWNILDFLVVLPSLVSLILR---LLGEGSEGLLSVLRLLRLLRLLRLLRR 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1662 AKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKS------GINDVYNFKTFGQSMILLFQMSTSAGW 1735
Cdd:pfam00520   78 FPGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCedenenPINGNSNFDSYPEALLWLFRTLTTEGW 157
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 320542214  1736 DGVLdaiineeacdppdndkgYPGNCGSATVGITFLLSYLVISFLIVINMYIAVI 1790
Cdd:pfam00520  158 GDIM-----------------PDTLDAGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
171-417 1.53e-41

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 153.98  E-value: 1.53e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   171 EVIFTGIYTFESAVKVMARGFIlcpFTYLRDAWNWLDFVVIALAYVTMGIDL------GNLAALRTFRVLRALKTVAIVP 244
Cdd:pfam00520    3 DYVFTVIFTLEMLLKFIALGFK---LSYFRSPWNILDFLVVLPSLVSLILRLlgegseGLLSVLRLLRLLRLLRLLRRFP 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   245 GLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFpldgswgnltdenwdyhnrnssnwysedeg 324
Cdd:pfam00520   80 GLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEDENE------------------------------ 129
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   325 isfplcgnisgagqcdddyvclqgfgpNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFL 404
Cdd:pfam00520  130 ---------------------------NPINGNSNFDSYPEALLWLFRTLTTEGWGDIMPDTLDAGTVLGKIFFVIFIIL 182
                          250
                   ....*....|...
gi 320542214   405 GSFYLVNLILAIV 417
Cdd:pfam00520  183 GGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
798-972 4.74e-39

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 146.66  E-value: 4.74e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   798 NYFFTATFAIEATMKLMAMSPKY-YFQEGWNIFDFIIV-----ALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLN 871
Cdd:pfam00520    3 DYVFTVIFTLEMLLKFIALGFKLsYFRSPWNILDFLVVlpslvSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRFPGLR 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   872 LLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE-WIESMW 950
Cdd:pfam00520   83 TLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEDENENPINGNSNFDSYPEALLWLFRTLTTEgWGDIMP 162
                          170       180
                   ....*....|....*....|..
gi 320542214   951 DCMYVGDVSCIPFFLATVVIGN 972
Cdd:pfam00520  163 DTLDAGTVLGKIFFVIFIILGG 184
 
Name Accession Description Interval E-value
Na_channel_gate cd13433
Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of ...
1492-1544 4.51e-28

Inactivation gate of the voltage-gated sodium channel alpha subunits; This region is part of the intracellular linker between domains III and IV of the alpha subunits of voltage-gated sodium channels. It is responsible for fast inactivation of the channel and essential for proper physiological function.


Pssm-ID: 240441  Cd Length: 54  Bit Score: 110.35  E-value: 4.51e-28
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|...
gi 320542214 1492 DNFNEQKKKAGGSLEMFMTEDQKKYYNAMKKMGSKKPLKAIPRPRWRPQAIVF 1544
Cdd:cd13433     1 DNFNQLKKKYGGGLDIFLTESQKKYYNAMKKLGSKKPQKPIPRPKNKFQGFIF 53
Na_trans_assoc pfam06512
Sodium ion transport-associated; Members of this family contain a region found exclusively in ...
998-1242 3.64e-69

Sodium ion transport-associated; Members of this family contain a region found exclusively in eukaryotic sodium channels or their subunits, many of which are voltage-gated. Members very often also contain between one and four copies of pfam00520 and, less often, one copy of pfam00612.


Pssm-ID: 253777  Cd Length: 230  Bit Score: 234.97  E-value: 3.64e-69
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   998 DNDTNKIAEAFNRIGRFKSWVKRNIADCFKLIRNKLTNQISDQPsgkgvcrcisaEHGDNELELGHDEILADGLIKKGIK 1077
Cdd:pfam06512    1 DGEMNNLQIAIARIQRGINWVKRNIRDFFKKLLKKKPKEIDEQT-----------EAEDNLLDKAVDDILSNHYLKEGNG 69
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1078 eqtQLEVAIGDGMEFTIHGDMKNNKPKkSKYLNNAT-----------------DDDTASINSYGshknrpFKDESHKGSA 1140
Cdd:pfam06512   70 ---TTSVAIGDGMEKTIHGDVKESDPM-SFITNPSLtvsvpiasgesdlenlnDEDTSSESSYG------FKEESKKGSA 139
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1141 ETMEGEEKrDASKEDLGLDEELDeegeceegPLDGDIIIHAHDEDILDeyPADCCPDSYYKKFPILAGDDDSPFWQGWGN 1220
Cdd:pfam06512  140 ETLKLEEK-DSSSSEGSTVDLEP--------PEEEEEEIAEEEEEVKE--PEDCFPEGCVRRFPCCAVDIDSGFGKGWWN 208
                          250       260
                   ....*....|....*....|..
gi 320542214  1221 LRLKTFQLIENKYFETAVITMI 1242
Cdd:pfam06512  209 LRKTCYQIVEHSWFETFIIFMI 230
DUF3451 pfam11933
Domain of unknown function (DUF3451); This presumed domain is functionally uncharacterized. ...
483-673 4.88e-45

Domain of unknown function (DUF3451); This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 199 to 238 amino acids in length. This domain is found associated with pfam06512, pfam00520. This domain has a conserved ADD sequence motif.


Pssm-ID: 256738  Cd Length: 222  Bit Score: 164.97  E-value: 4.88e-45
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   483 PTYSCISYELFVGGEKGNDDNNKEKMSIRSVEVESES------------------------------------------- 519
Cdd:pfam11933    1 SDYSKLSSESAKERRNRNDKNKKEEHSIGSEEGDSEKepksesadgrkrcrfllrktrkvsqsllslpgspfntrrgsrg 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   520 --YTIRnGRGRFgiPGSDRkplvlstyqdaqqhlPYADDSNAVTPMSEENGAIIVPVYYgNLGSRHSSYTSHQSRIS--Y 595
Cdd:pfam11933   81 siFSFR-GRGRD--VGSEN---------------DFADDENSVTEMSESRGSLFLPWRY-ERRSSHSSYTSHSSRIFpkL 141
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   596 TSHGDLLGGMAVMGVSTMTKESKLRNrNTRNQSVGATN--GGTTCLDTNHKLDHRDYEIGLECTDEAGKIKHHDNPFIEP 673
Cdd:pfam11933  142 TSNGKLLGTVDCNGVVSLTGEDVLRA-SPGGNLLPECTmeKEGGTTDTEGKTHLRSLELSVDLLEEPVPGARRDRALSEV 220
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1268-1490 1.67e-55

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 194.04  E-value: 1.67e-55
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1268 YMDRIFTVIFFLEMLIKWLALGFKV-YFTNAWCWLDFVIVMVSLINFVASLVGAGGIQAFKTMRTLRALRPLRAMSRMQG 1346
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGFKLsYFRSPWNILDFLVVLPSLVSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRFPG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1347 MRVVVNALVQAIPSIFNVLLVCLIFWLIFAIMGVQLFAGKYFKCEDmngtklsheiipnrnacesENYTWVNSAMNFDHV 1426
Cdd:pfam00520   81 LRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCED-------------------ENENPINGNSNFDSY 141
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 320542214  1427 GNAYLCLFQVATFKGWIQIMNDAIDsrevdkqpirETNIYMYLYFVFFIIFGSFFTLNLFIGVI 1490
Cdd:pfam00520  142 PEALLWLFRTLTTEGWGDIMPDTLD----------AGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1584-1790 8.32e-44

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 160.53  E-value: 8.32e-44
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1584 YLNAIFVVIFSSECLLKIFALR--YHYFIEPWNLFDVVVVILSILGLVLSdiiEKYFVSPTLLRVVRVAKVGRVLRLVKG 1661
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGfkLSYFRSPWNILDFLVVLPSLVSLILR---LLGEGSEGLLSVLRLLRLLRLLRLLRR 77
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1662 AKGIRTLLFALAMSLPALFNICLLLFLVMFIFAIFGMSFFMHVKEKS------GINDVYNFKTFGQSMILLFQMSTSAGW 1735
Cdd:pfam00520   78 FPGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCedenenPINGNSNFDSYPEALLWLFRTLTTEGW 157
                          170       180       190       200       210
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 320542214  1736 DGVLdaiineeacdppdndkgYPGNCGSATVGITFLLSYLVISFLIVINMYIAVI 1790
Cdd:pfam00520  158 GDIM-----------------PDTLDAGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
171-417 1.53e-41

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 153.98  E-value: 1.53e-41
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   171 EVIFTGIYTFESAVKVMARGFIlcpFTYLRDAWNWLDFVVIALAYVTMGIDL------GNLAALRTFRVLRALKTVAIVP 244
Cdd:pfam00520    3 DYVFTVIFTLEMLLKFIALGFK---LSYFRSPWNILDFLVVLPSLVSLILRLlgegseGLLSVLRLLRLLRLLRLLRRFP 79
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   245 GLKTIVGAVIESVKNLRDVIILTMFSLSVFALMGLQIYMGVLTQKCIKKFpldgswgnltdenwdyhnrnssnwysedeg 324
Cdd:pfam00520   80 GLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEDENE------------------------------ 129
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   325 isfplcgnisgagqcdddyvclqgfgpNPNYGYTSFDSFGWAFLSAFRLMTQDFWEDLYQLVLRAAGPWHMLFFIVIIFL 404
Cdd:pfam00520  130 ---------------------------NPINGNSNFDSYPEALLWLFRTLTTEGWGDIMPDTLDAGTVLGKIFFVIFIIL 182
                          250
                   ....*....|...
gi 320542214   405 GSFYLVNLILAIV 417
Cdd:pfam00520  183 GGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
798-972 4.74e-39

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 146.66  E-value: 4.74e-39
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   798 NYFFTATFAIEATMKLMAMSPKY-YFQEGWNIFDFIIV-----ALSLLELGLEGVQGLSVLRSFRLLRVFKLAKSWPTLN 871
Cdd:pfam00520    3 DYVFTVIFTLEMLLKFIALGFKLsYFRSPWNILDFLVVlpslvSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRFPGLR 82
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   872 LLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGKNYHDHKDRFPDGDLPRWNFTDFMHSFMIVFRVLCGE-WIESMW 950
Cdd:pfam00520   83 TLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEDENENPINGNSNFDSYPEALLWLFRTLTTEgWGDIMP 162
                          170       180
                   ....*....|....*....|..
gi 320542214   951 DCMYVGDVSCIPFFLATVVIGN 972
Cdd:pfam00520  163 DTLDAGTVLGKIFFVIFIILGG 184
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
1588-1797 2.59e-11

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 254584 [Multi-domain]  Cd Length: 423  Bit Score: 66.60  E-value: 2.59e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1588 IFVVIFSSECLLKIFALRYHYFIEPWNLFDVVVVILSILGLVLSdiIEKYFVSPTLLRVV-----------RVAKVGRVL 1656
Cdd:pfam08016  217 VFVLYFVVAEITKIRREGPRYLRSVWNLLDLAIVALSVVVIVLH--IYRDFLATQLWKQVeaspvdftdfdRVARLDQLY 294
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214  1657 RLVKGA-------KGIRTLLF---------ALAMSLPALFNICLLLFLVMFIFAIFGMSFFMhvkeksgiNDVYNFKTFG 1720
Cdd:pfam08016  295 RIILAFllfltwlKLFKVLRFnrtmslftkTLSRALKELLGFAVMFVILFLAYAQLGYLLFG--------SQVDNFSNFV 366
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 320542214  1721 QSMILLFQ-MSTSAGWdgvldaiineeacdppdNDKGYPGNcgsaTVGITFLLSYLVISFLIVINMYIAVILENYSQA 1797
Cdd:pfam08016  367 KSILTLFRtLCGDFGY-----------------TEIFSGNR----VLGPLLFLTFVFLVIFILLNLFLAIINDSYVEV 423
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
849-943 5.52e-04

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 254584 [Multi-domain]  Cd Length: 423  Bit Score: 43.10  E-value: 5.52e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 320542214   849 LSVLRSFRLLRVFKlakswpTLNLLISIMGRTMGALGNLTFVLCIIIFIFAVMGMQLFGkNYHdhkdrfpdgdlprWNFT 928
Cdd:pfam08016  304 LTWLKLFKVLRFNR------TMSLFTKTLSRALKELLGFAVMFVILFLAYAQLGYLLFG-SQV-------------DNFS 363
                           90
                   ....*....|....*
gi 320542214   929 DFMHSFMIVFRVLCG 943
Cdd:pfam08016  364 NFVKSILTLFRTLCG 378
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH