NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307568067|pdb|2XG2|P]
View 

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
rplO PRK05592
50S ribosomal protein L15; Reviewed
1-143 1.61e-54

50S ribosomal protein L15; Reviewed


:

Pssm-ID: 235523  Cd Length: 146  Bit Score: 170.66  E-value: 1.61e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_P         1 MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKdPRRFEGGRSTTLMRLPKRGMQGqvpgeIKRPRY 80
Cdd:PRK05592   1 MKLNELKPAPGSRKARKRVGRGIGSGLGKTAGRGHKGQKARSGGGV-RPGFEGGQMPLYRRLPKRGFTN-----IFRKEY 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
2XG2_P        81 QGVNLKDLARFE--GEVTPELLVRAGLLKKGY-RLKILGEGE-AKPLKVVAHAFSKSALEKLKAAGG 143
Cdd:PRK05592  75 AVVNLGDLNKFEegTEVTLEALKAAGLIRKNIkGVKVLGNGElTKKLTVKAHKFSKSAKEAIEAAGG 141
 
Name Accession Description Interval E-value
rplO PRK05592
50S ribosomal protein L15; Reviewed
1-143 1.61e-54

50S ribosomal protein L15; Reviewed


Pssm-ID: 235523  Cd Length: 146  Bit Score: 170.66  E-value: 1.61e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_P         1 MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKdPRRFEGGRSTTLMRLPKRGMQGqvpgeIKRPRY 80
Cdd:PRK05592   1 MKLNELKPAPGSRKARKRVGRGIGSGLGKTAGRGHKGQKARSGGGV-RPGFEGGQMPLYRRLPKRGFTN-----IFRKEY 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
2XG2_P        81 QGVNLKDLARFE--GEVTPELLVRAGLLKKGY-RLKILGEGE-AKPLKVVAHAFSKSALEKLKAAGG 143
Cdd:PRK05592  75 AVVNLGDLNKFEegTEVTLEALKAAGLIRKNIkGVKVLGNGElTKKLTVKAHKFSKSAKEAIEAAGG 141
50S_ribosomal_protein_L15 TIGR01071
ribosomal protein L15, bacterial/organelle; [Protein synthesis, Ribosomal proteins: synthesis ...
2-143 1.05e-35

ribosomal protein L15, bacterial/organelle; [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 273428  Cd Length: 145  Bit Score: 122.43  E-value: 1.05e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_P          2 KLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGlKDPRRFEGGRSTTLMRLPKRGMQGQVpgeiKRPRYQ 81
Cdd:TIGR01071   1 KLHELKPAKGSKKRRKRVGRGIGSGLGKTSGRGHKGQKARSGG-KVRRGFEGGQMPLYRRLPKRGFSNKR----FKKEYA 75
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
2XG2_P         82 GVNLKDLARFEG---EVTPELLVRAGLL-KKGYRLKILGEGE-AKPLKVVAHAFSKSALEKLKAAGG 143
Cdd:TIGR01071  76 EVNLGKLAKLFDngeVVTLETLKEKGLItKKIKFVKVLGNGKlTKPLTVKAHRVSKSAKAAIEAAGG 142
RplO COG0200
Ribosomal protein L15 [Translation, ribosomal structure and biogenesis]
1-149 1.25e-33

Ribosomal protein L15 [Translation, ribosomal structure and biogenesis]


Pssm-ID: 223278  Cd Length: 152  Bit Score: 116.98  E-value: 1.25e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_P        1 MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGRSTTLMRLPKRGMqgqVPGEIKRPRY 80
Cdd:COG0200   1 MRLNDLKPARGSKKTRKRVGRGIGSGLGKTGGRGHKGQKARSGHKWVRPGFEGGQMPLYRRLPKRGF---TNSKFKKVEY 77
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
2XG2_P       81 QGVNLKDLARFE---GEVTPELLVRAGLLKKGYRL-KILGEGE---AKPLKVVAhAFSKSALEKLKAAGGEPVLLE 149
Cdd:COG0200  78 AVVNLGKLAELLpegEEVTLASLKAAGVIRKLKDLvKVLGNGKltkAVPVKVKA-KASKSAIEKIEAAGGKVELIE 152
Ribosomal_L18e pfam00828
Ribosomal protein L18e/L15; This family includes eukaryotic L18 as well as prokaryotic L15.
27-148 6.05e-22

Ribosomal protein L18e/L15; This family includes eukaryotic L18 as well as prokaryotic L15.


Pssm-ID: 250160  Cd Length: 122  Bit Score: 85.76  E-value: 6.05e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_P         27 HGKTATRGHKGQKSRSGGLKdpRRFEGGRSTTLMRLPKRGMQgqvPGEIKRPRYQGVNLKDLARFE----GEVTPELLVR 102
Cdd:pfam00828   3 IGKTRGRGRKGGRGRAGGQK--HHFEGGQVPLYRRLGKRGFR---KLFKSRKNRPPVNLSKLDRKMlkdgEEVDGETLVV 77
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
2XG2_P        103 AGLLKkgYRLKILGEGEA-KPLKVVAHAFSKSALEKLKAAGGEPVLL 148
Cdd:pfam00828  78 VGTVT--DDVKVLGNGELtKPLTVKALKFSKSAREKIEKAGGEVILL 122
PTZ00160 PTZ00160
60S ribosomal protein L27a; Provisional
105-147 2.47e-04

60S ribosomal protein L27a; Provisional


Pssm-ID: 185489  Cd Length: 147  Bit Score: 37.69  E-value: 2.47e-04
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*
2XG2_P       105 LLKKGYrLKILGEGE--AKPLKVVAHAFSKSALEKLKAAGGEPVL 147
Cdd:PTZ00160 102 VTKAGY-FKVLGKGHlpKQPVIVKARYFSKKAEKKIKAVGGACVL 145
 
Name Accession Description Interval E-value
rplO PRK05592
50S ribosomal protein L15; Reviewed
1-143 1.61e-54

50S ribosomal protein L15; Reviewed


Pssm-ID: 235523  Cd Length: 146  Bit Score: 170.66  E-value: 1.61e-54
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_P         1 MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKdPRRFEGGRSTTLMRLPKRGMQGqvpgeIKRPRY 80
Cdd:PRK05592   1 MKLNELKPAPGSRKARKRVGRGIGSGLGKTAGRGHKGQKARSGGGV-RPGFEGGQMPLYRRLPKRGFTN-----IFRKEY 74
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
2XG2_P        81 QGVNLKDLARFE--GEVTPELLVRAGLLKKGY-RLKILGEGE-AKPLKVVAHAFSKSALEKLKAAGG 143
Cdd:PRK05592  75 AVVNLGDLNKFEegTEVTLEALKAAGLIRKNIkGVKVLGNGElTKKLTVKAHKFSKSAKEAIEAAGG 141
50S_ribosomal_protein_L15 TIGR01071
ribosomal protein L15, bacterial/organelle; [Protein synthesis, Ribosomal proteins: synthesis ...
2-143 1.05e-35

ribosomal protein L15, bacterial/organelle; [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 273428  Cd Length: 145  Bit Score: 122.43  E-value: 1.05e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_P          2 KLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGlKDPRRFEGGRSTTLMRLPKRGMQGQVpgeiKRPRYQ 81
Cdd:TIGR01071   1 KLHELKPAKGSKKRRKRVGRGIGSGLGKTSGRGHKGQKARSGG-KVRRGFEGGQMPLYRRLPKRGFSNKR----FKKEYA 75
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
2XG2_P         82 GVNLKDLARFEG---EVTPELLVRAGLL-KKGYRLKILGEGE-AKPLKVVAHAFSKSALEKLKAAGG 143
Cdd:TIGR01071  76 EVNLGKLAKLFDngeVVTLETLKEKGLItKKIKFVKVLGNGKlTKPLTVKAHRVSKSAKAAIEAAGG 142
RplO COG0200
Ribosomal protein L15 [Translation, ribosomal structure and biogenesis]
1-149 1.25e-33

Ribosomal protein L15 [Translation, ribosomal structure and biogenesis]


Pssm-ID: 223278  Cd Length: 152  Bit Score: 116.98  E-value: 1.25e-33
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_P        1 MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGRSTTLMRLPKRGMqgqVPGEIKRPRY 80
Cdd:COG0200   1 MRLNDLKPARGSKKTRKRVGRGIGSGLGKTGGRGHKGQKARSGHKWVRPGFEGGQMPLYRRLPKRGF---TNSKFKKVEY 77
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
2XG2_P       81 QGVNLKDLARFE---GEVTPELLVRAGLLKKGYRL-KILGEGE---AKPLKVVAhAFSKSALEKLKAAGGEPVLLE 149
Cdd:COG0200  78 AVVNLGKLAELLpegEEVTLASLKAAGVIRKLKDLvKVLGNGKltkAVPVKVKA-KASKSAIEKIEAAGGKVELIE 152
Ribosomal_L18e pfam00828
Ribosomal protein L18e/L15; This family includes eukaryotic L18 as well as prokaryotic L15.
27-148 6.05e-22

Ribosomal protein L18e/L15; This family includes eukaryotic L18 as well as prokaryotic L15.


Pssm-ID: 250160  Cd Length: 122  Bit Score: 85.76  E-value: 6.05e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_P         27 HGKTATRGHKGQKSRSGGLKdpRRFEGGRSTTLMRLPKRGMQgqvPGEIKRPRYQGVNLKDLARFE----GEVTPELLVR 102
Cdd:pfam00828   3 IGKTRGRGRKGGRGRAGGQK--HHFEGGQVPLYRRLGKRGFR---KLFKSRKNRPPVNLSKLDRKMlkdgEEVDGETLVV 77
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*..
2XG2_P        103 AGLLKkgYRLKILGEGEA-KPLKVVAHAFSKSALEKLKAAGGEPVLL 148
Cdd:pfam00828  78 VGTVT--DDVKVLGNGELtKPLTVKALKFSKSAREKIEKAGGEVILL 122
PRK04005 PRK04005
50S ribosomal protein L18e; Provisional
74-149 3.01e-06

50S ribosomal protein L18e; Provisional


Pssm-ID: 235196  Cd Length: 111  Bit Score: 42.14  E-value: 3.01e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_P        74 EIKRPR--YQGVNLKDLARF--EGEVtpelLVRAGllkkgyrlKILGEGE-AKPLKVVAHAFSKSALEKLKAAGGEPVLL 148
Cdd:PRK04005  27 RLEKPRrrRAEVNLSKINRYakEGDT----VVVPG--------KVLGSGKlDHKVTVAALSFSETAKEKIEEAGGKALTI 94

                 .
2XG2_P       149 E 149
Cdd:PRK04005  95 E 95
RPL18A COG1727
Ribosomal protein L18E [Translation, ribosomal structure and biogenesis]
74-149 6.54e-05

Ribosomal protein L18E [Translation, ribosomal structure and biogenesis]


Pssm-ID: 224641  Cd Length: 122  Bit Score: 38.85  E-value: 6.54e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
2XG2_P       74 EIKRPRYQGVNLKDLARFEGEvtPELLVRAGllkkgyrlKILGEG-EAKPLKVVAHAFSKSALEKLKAAGGEPVLLE 149
Cdd:COG1727  40 EKPRRNRAEVNVSKINRYAKE--GDTVVVPG--------KVLGDGkLDKKVTVAALRFSKTAREKIEEAGGECLTLE 106
rpl15p PRK06419
50S ribosomal protein L15P; Reviewed
113-149 7.42e-05

50S ribosomal protein L15P; Reviewed


Pssm-ID: 235799  Cd Length: 148  Bit Score: 39.04  E-value: 7.42e-05
                         10        20        30
                 ....*....|....*....|....*....|....*...
2XG2_P       113 KILGEGE-AKPLKVVAHAFSKSALEKLKAAGGEPVLLE 149
Cdd:PRK06419 109 KVLGGGKvTRPLVIKADAFSEKAIEKIEAAGGEVVLSE 146
PTZ00160 PTZ00160
60S ribosomal protein L27a; Provisional
105-147 2.47e-04

60S ribosomal protein L27a; Provisional


Pssm-ID: 185489  Cd Length: 147  Bit Score: 37.69  E-value: 2.47e-04
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*
2XG2_P       105 LLKKGYrLKILGEGE--AKPLKVVAHAFSKSALEKLKAAGGEPVL 147
Cdd:PTZ00160 102 VTKAGY-FKVLGKGHlpKQPVIVKARYFSKKAEKKIKAVGGACVL 145
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH