NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307568048|pdb|2XG2|3]
View 

Chain 3, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The 70s Ribosome (part 4 Of 4)

Protein classification: 50S ribosomal protein L30 binds the 23SrRNA as well as the 5S rRNA.

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ribosomal_L30 cd01658
Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one ...
4-57 2.86e-22

Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one of the smallest ribosomal proteins with a molecular mass of about 7kDa. L30 binds the 23SrRNA as well as the 5S rRNA and is one of five ribosomal proteins that mediate the interactions 5S rRNA makes with the ribosome. The eukaryotic L30 members have N- and/or C-terminal extensions not found in their prokaryotic orthologs. L30 is closely related to the ribosomal L7 protein found in eukaryotes and archaea.


:

Pssm-ID: 100100  Cd Length: 54  Bit Score: 81.31  E-value: 2.86e-22
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....
2XG2_3       4 LKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVE 57
Cdd:cd01658  1 LKITLVKSLIGRPKKQRATLKALGLKKINQTVVHKDTPSIRGMINKVKHLVKVE 54
 
Name Accession Description Interval E-value
Ribosomal_L30 cd01658
Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one ...
4-57 2.86e-22

Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one of the smallest ribosomal proteins with a molecular mass of about 7kDa. L30 binds the 23SrRNA as well as the 5S rRNA and is one of five ribosomal proteins that mediate the interactions 5S rRNA makes with the ribosome. The eukaryotic L30 members have N- and/or C-terminal extensions not found in their prokaryotic orthologs. L30 is closely related to the ribosomal L7 protein found in eukaryotes and archaea.


Pssm-ID: 100100  Cd Length: 54  Bit Score: 81.31  E-value: 2.86e-22
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....
2XG2_3       4 LKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVE 57
Cdd:cd01658  1 LKITLVKSLIGRPKKQRATLKALGLKKINQTVVHKDTPSIRGMINKVKHLVKVE 54
rpmD PRK05611
50S ribosomal protein L30; Reviewed
1-57 6.05e-25

50S ribosomal protein L30; Reviewed


Pssm-ID: 180163  Cd Length: 59  Bit Score: 88.23  E-value: 6.05e-25
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*..
2XG2_3        1 MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVE 57
Cdd:PRK05611  1 MKTLKITLVKSLIGRKPKQRATLRGLGLRKINSTVELEDTPAIRGMINKVSHLVKVE 57
rpmD_bact TIGR01308
ribosomal protein L30, bacterial/organelle; This model describes bacterial (and organellar) ...
4-58 2.28e-20

ribosomal protein L30, bacterial/organelle; This model describes bacterial (and organellar) 50S ribosomal protein L30. Homologous ribosomal proteins of the eukaryotic cytosol and of the archaea differ substantially in architecture, from bacterial L30 and also from each other, and are described by separate models. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 130375  Cd Length: 55  Bit Score: 76.58  E-value: 2.28e-20
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
2XG2_3         4 LKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVEV 58
Cdd:TIGR01308  1 IKVTLVRSLIGRPKKQRKTLKALGLRKIGRQVVLEDNPAIRGMVNKVKHLVKVEE 55
Ribosomal_L30 pfam00327
Ribosomal protein L30p/L7e; This family includes prokaryotic L30 and eukaryotic L7.
4-54 4.69e-15

Ribosomal protein L30p/L7e; This family includes prokaryotic L30 and eukaryotic L7.


Pssm-ID: 249772  Cd Length: 52  Bit Score: 62.85  E-value: 4.69e-15
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
2XG2_3         4 LKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLV 54
Cdd:pfam00327  2 LKITRIRSIIGRPPKQKKTLKLLGLRKINQTVFVKDTPAIRGMLRKVKHLV 52
RpmD COG1841
Ribosomal protein L30/L7E [Translation, ribosomal structure and biogenesis]; linked to ...
4-57 1.31e-14

Ribosomal protein L30/L7E [Translation, ribosomal structure and biogenesis]; linked to 3D-structure


Pssm-ID: 224754  Cd Length: 55  Bit Score: 61.78  E-value: 1.31e-14
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....
2XG2_3       4 LKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVE 57
Cdd:COG1841  1 LKVTLIRSPIGRPPKIRKTLRLLGLRKINHTVIVEDTPAVRGMLNKVKHLVTVG 54
 
Name Accession Description Interval E-value
Ribosomal_L30 cd01658
Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one ...
4-57 2.86e-22

Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one of the smallest ribosomal proteins with a molecular mass of about 7kDa. L30 binds the 23SrRNA as well as the 5S rRNA and is one of five ribosomal proteins that mediate the interactions 5S rRNA makes with the ribosome. The eukaryotic L30 members have N- and/or C-terminal extensions not found in their prokaryotic orthologs. L30 is closely related to the ribosomal L7 protein found in eukaryotes and archaea.


Pssm-ID: 100100  Cd Length: 54  Bit Score: 81.31  E-value: 2.86e-22
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....
2XG2_3       4 LKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVE 57
Cdd:cd01658  1 LKITLVKSLIGRPKKQRATLKALGLKKINQTVVHKDTPSIRGMINKVKHLVKVE 54
rpmD PRK05611
50S ribosomal protein L30; Reviewed
1-57 6.05e-25

50S ribosomal protein L30; Reviewed


Pssm-ID: 180163  Cd Length: 59  Bit Score: 88.23  E-value: 6.05e-25
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*..
2XG2_3        1 MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVE 57
Cdd:PRK05611  1 MKTLKITLVKSLIGRKPKQRATLRGLGLRKINSTVELEDTPAIRGMINKVSHLVKVE 57
rpmD_bact TIGR01308
ribosomal protein L30, bacterial/organelle; This model describes bacterial (and organellar) ...
4-58 2.28e-20

ribosomal protein L30, bacterial/organelle; This model describes bacterial (and organellar) 50S ribosomal protein L30. Homologous ribosomal proteins of the eukaryotic cytosol and of the archaea differ substantially in architecture, from bacterial L30 and also from each other, and are described by separate models. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 130375  Cd Length: 55  Bit Score: 76.58  E-value: 2.28e-20
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
2XG2_3         4 LKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVEV 58
Cdd:TIGR01308  1 IKVTLVRSLIGRPKKQRKTLKALGLRKIGRQVVLEDNPAIRGMVNKVKHLVKVEE 55
Ribosomal_L30_like cd00355
Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one ...
5-57 3.54e-17

Ribosomal protein L30, which is found in eukaryotes and prokaryotes but not in archaea, is one of the smallest ribosomal proteins with a molecular mass of about 7kDa. L30 binds the 23SrRNA as well as the 5S rRNA and is one of five ribosomal proteins that mediate the interactions 5S rRNA makes with the ribosome. The eukaryotic L30 members have N- and/or C-terminal extensions not found in their prokaryotic orthologs. L30 is closely related to the ribosomal L7 protein found in eukaryotes and archaea.


Pssm-ID: 100098  Cd Length: 53  Bit Score: 68.20  E-value: 3.54e-17
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|...
2XG2_3       5 KVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVE 57
Cdd:cd00355  1 KVTRVRSLIGRPPKQRKTLKALGLRKINQTVFVKDTPSIRGMLRKVKHLVTVG 53
Ribosomal_L30 pfam00327
Ribosomal protein L30p/L7e; This family includes prokaryotic L30 and eukaryotic L7.
4-54 4.69e-15

Ribosomal protein L30p/L7e; This family includes prokaryotic L30 and eukaryotic L7.


Pssm-ID: 249772  Cd Length: 52  Bit Score: 62.85  E-value: 4.69e-15
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|.
2XG2_3         4 LKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLV 54
Cdd:pfam00327  2 LKITRIRSIIGRPPKQKKTLKLLGLRKINQTVFVKDTPAIRGMLRKVKHLV 52
RpmD COG1841
Ribosomal protein L30/L7E [Translation, ribosomal structure and biogenesis]; linked to ...
4-57 1.31e-14

Ribosomal protein L30/L7E [Translation, ribosomal structure and biogenesis]; linked to 3D-structure


Pssm-ID: 224754  Cd Length: 55  Bit Score: 61.78  E-value: 1.31e-14
                       10        20        30        40        50
               ....*....|....*....|....*....|....*....|....*....|....
2XG2_3       4 LKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVE 57
Cdd:COG1841  1 LKVTLIRSPIGRPPKIRKTLRLLGLRKINHTVIVEDTPAVRGMLNKVKHLVTVG 54
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH