NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307568026|pdb|2XG1G| ]
View 

Chain G, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The 70s Ribosome (part 3 Of 4)

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PRK05302 PRK05302
30S ribosomal protein S7; Validated
1-156 1.87e-95

30S ribosomal protein S7; Validated


:

Pssm-ID: 235398  Cd Length: 156  Bit Score: 275.44  E-value: 1.87e-95
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G          1 MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRV 80
Cdd:PRK05302   1 MPRRRRAPKREVLPDPKYGSVLVTKFINKLMLDGKKSVAEKIVYGALDIIEEKTGKDPLEVFEKALENVKPVVEVKSRRV 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
2XG1G         81 GGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW 156
Cdd:PRK05302  81 GGATYQVPVEVRPERRQALAMRWLVEAARKRGEKTMAERLANELLDAANNRGAAVKKREDTHRMAEANKAFAHYRW 156
 
Name Accession Description Interval E-value
PRK05302 PRK05302
30S ribosomal protein S7; Validated
1-156 1.87e-95

30S ribosomal protein S7; Validated


Pssm-ID: 235398  Cd Length: 156  Bit Score: 275.44  E-value: 1.87e-95
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G          1 MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRV 80
Cdd:PRK05302   1 MPRRRRAPKREVLPDPKYGSVLVTKFINKLMLDGKKSVAEKIVYGALDIIEEKTGKDPLEVFEKALENVKPVVEVKSRRV 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
2XG1G         81 GGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW 156
Cdd:PRK05302  81 GGATYQVPVEVRPERRQALAMRWLVEAARKRGEKTMAERLANELLDAANNRGAAVKKREDTHRMAEANKAFAHYRW 156
Ribosomal_S7 pfam00177
Ribosomal protein S7p/S5e; This family contains ribosomal protein S7 from prokaryotes and S5 ...
1-149 2.38e-79

Ribosomal protein S7p/S5e; This family contains ribosomal protein S7 from prokaryotes and S5 from eukaryotes.


Pssm-ID: 249655  Cd Length: 149  Bit Score: 234.36  E-value: 2.38e-79
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G           1 MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRV 80
Cdd:pfam00177   1 MPRRGRAKKREVLPDPKYNSALVEKLINKLMKDGKKSLAEKIVYKAFEIIEEKTGKNPLEVLVQAIENVKPRVEVKSRRV 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
2XG1G          81 GGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANR 149
Cdd:pfam00177  81 GGATYQVPVEVSPERRVALAIRWILKAARKRSGKSMAEKLANELIDAANNKGSAIKKKEETHRMAEANR 149
RpsG COG0049
Ribosomal protein S7 [Translation, ribosomal structure and biogenesis]
3-149 1.11e-77

Ribosomal protein S7 [Translation, ribosomal structure and biogenesis]


Pssm-ID: 223127  Cd Length: 148  Bit Score: 230.16  E-value: 1.11e-77
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G         3 RRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGG 82
Cdd:COG0049   2 RRHTAGKREVLPDPKYNSVIVERLINKIMRDGKKSLAEKIVYGAFDIIEKKTGQNPLQVFEKAIENVKPREEVKSRRVGG 81
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
2XG1G        83 ANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANR 149
Cdd:COG0049  82 ATYQVPVEVRPRRRVALALRWIVEGARKRNEKTMAERLANELIDAANNTGAAIKKKEDTHRMAEANR 148
rpsG_bact TIGR01029
ribosomal protein S7, bacterial/organelle; This model describes the bacterial and organellar ...
3-156 1.48e-73

ribosomal protein S7, bacterial/organelle; This model describes the bacterial and organellar branch of the ribosomal protein S7 family (includes prokaroytic S7 and eukaryotic S5). The eukaryotic and archaeal branch is described by model TIGR01028 [Protein synthesis, Ribosomal proteins: synthesis and modification].


Pssm-ID: 233238  Cd Length: 154  Bit Score: 219.86  E-value: 1.48e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G           3 RRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGG 82
Cdd:TIGR01029   1 RKRKAEKRKIPPDPVYGSVLLNKFINRVMKDGKKSLAESIVYKAFERIAKKTGEDPLEVFEQALENVKPLVEVKSRRVGG 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
2XG1G          83 ANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW 156
Cdd:TIGR01029  81 ATYQVPVEVRPSRRYALAIRWLIEAARKRGGKSMAERLANEILDAANNTGAAIKKREDTHRMAEANKAFAHYRW 154
rps7 CHL00053
ribosomal protein S7
1-155 5.60e-66

ribosomal protein S7


Pssm-ID: 176994  Cd Length: 155  Bit Score: 200.50  E-value: 5.60e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G          1 MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRV 80
Cdd:CHL00053   1 MSRRGTAKKRTAKPDPIYRNRLVNMLVNRILKSGKKSLAYRIVYRALKKIQQKTEKNPLSVLRQAIRNVTPDVEVKARRV 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
2XG1G         81 GGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYR 155
Cdd:CHL00053  81 GGSTYQVPIEIGSTRGKALAIRWLLKASRKRSGRNMAFKLSSELVDAAKGSGNAIRKKEETHRMAEANRAFAHFR 155
PTZ00091 PTZ00091
40S ribosomal protein S5; Provisional
34-149 7.00e-15

40S ribosomal protein S5; Provisional


Pssm-ID: 185439  Cd Length: 193  Bit Score: 67.87  E-value: 7.00e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G         34 GKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEvrSRRVG--GANYQVPMEVSPRRQQSLALRWLVQAAnqr 111
Cdd:PTZ00091  73 GKKLLAVRIVKHAFEIIHLLTDKNPLQVLVDAVQNGGPRED--STRVGsgGVVRRQAVDVSPLRRVNQAIYLICKGA--- 147
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
2XG1G        112 peRRAAVR--------IAHELMDAAEG--KGGAVKKKEDVERMAEANR 149
Cdd:PTZ00091 148 --REAAFRniktiaecLADEIINASKEssNSYAIKKKDEVERVAKANR 193
 
Name Accession Description Interval E-value
PRK05302 PRK05302
30S ribosomal protein S7; Validated
1-156 1.87e-95

30S ribosomal protein S7; Validated


Pssm-ID: 235398  Cd Length: 156  Bit Score: 275.44  E-value: 1.87e-95
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G          1 MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRV 80
Cdd:PRK05302   1 MPRRRRAPKREVLPDPKYGSVLVTKFINKLMLDGKKSVAEKIVYGALDIIEEKTGKDPLEVFEKALENVKPVVEVKSRRV 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
2XG1G         81 GGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW 156
Cdd:PRK05302  81 GGATYQVPVEVRPERRQALAMRWLVEAARKRGEKTMAERLANELLDAANNRGAAVKKREDTHRMAEANKAFAHYRW 156
Ribosomal_S7 pfam00177
Ribosomal protein S7p/S5e; This family contains ribosomal protein S7 from prokaryotes and S5 ...
1-149 2.38e-79

Ribosomal protein S7p/S5e; This family contains ribosomal protein S7 from prokaryotes and S5 from eukaryotes.


Pssm-ID: 249655  Cd Length: 149  Bit Score: 234.36  E-value: 2.38e-79
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G           1 MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRV 80
Cdd:pfam00177   1 MPRRGRAKKREVLPDPKYNSALVEKLINKLMKDGKKSLAEKIVYKAFEIIEEKTGKNPLEVLVQAIENVKPRVEVKSRRV 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
2XG1G          81 GGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANR 149
Cdd:pfam00177  81 GGATYQVPVEVSPERRVALAIRWILKAARKRSGKSMAEKLANELIDAANNKGSAIKKKEETHRMAEANR 149
RpsG COG0049
Ribosomal protein S7 [Translation, ribosomal structure and biogenesis]
3-149 1.11e-77

Ribosomal protein S7 [Translation, ribosomal structure and biogenesis]


Pssm-ID: 223127  Cd Length: 148  Bit Score: 230.16  E-value: 1.11e-77
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G         3 RRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGG 82
Cdd:COG0049   2 RRHTAGKREVLPDPKYNSVIVERLINKIMRDGKKSLAEKIVYGAFDIIEKKTGQNPLQVFEKAIENVKPREEVKSRRVGG 81
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
2XG1G        83 ANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANR 149
Cdd:COG0049  82 ATYQVPVEVRPRRRVALALRWIVEGARKRNEKTMAERLANELIDAANNTGAAIKKKEDTHRMAEANR 148
rpsG_bact TIGR01029
ribosomal protein S7, bacterial/organelle; This model describes the bacterial and organellar ...
3-156 1.48e-73

ribosomal protein S7, bacterial/organelle; This model describes the bacterial and organellar branch of the ribosomal protein S7 family (includes prokaroytic S7 and eukaryotic S5). The eukaryotic and archaeal branch is described by model TIGR01028 [Protein synthesis, Ribosomal proteins: synthesis and modification].


Pssm-ID: 233238  Cd Length: 154  Bit Score: 219.86  E-value: 1.48e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G           3 RRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGG 82
Cdd:TIGR01029   1 RKRKAEKRKIPPDPVYGSVLLNKFINRVMKDGKKSLAESIVYKAFERIAKKTGEDPLEVFEQALENVKPLVEVKSRRVGG 80
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
2XG1G          83 ANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW 156
Cdd:TIGR01029  81 ATYQVPVEVRPSRRYALAIRWLIEAARKRGGKSMAERLANEILDAANNTGAAIKKREDTHRMAEANKAFAHYRW 154
rps7 CHL00053
ribosomal protein S7
1-155 5.60e-66

ribosomal protein S7


Pssm-ID: 176994  Cd Length: 155  Bit Score: 200.50  E-value: 5.60e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G          1 MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRV 80
Cdd:CHL00053   1 MSRRGTAKKRTAKPDPIYRNRLVNMLVNRILKSGKKSLAYRIVYRALKKIQQKTEKNPLSVLRQAIRNVTPDVEVKARRV 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
2XG1G         81 GGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAVRIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYR 155
Cdd:CHL00053  81 GGSTYQVPIEIGSTRGKALAIRWLLKASRKRSGRNMAFKLSSELVDAAKGSGNAIRKKEETHRMAEANRAFAHFR 155
PRK04027 PRK04027
30S ribosomal protein S7P; Reviewed
23-149 3.30e-27

30S ribosomal protein S7P; Reviewed


Pssm-ID: 235204  Cd Length: 195  Bit Score: 101.52  E-value: 3.30e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G         23 VTAFINKIMRD----GKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQS 98
Cdd:PRK04027  60 VERLINKLMRTerntGKKQKAYNIVKEAFEIIEKRTKQNPIQVLVDAIENAAPREETTRIKYGGISYPKAVDVSPQRRVD 139
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
2XG1G         99 LALRWLVQAANQ---RPERRAAVRIAHELMDAAEG--KGGAVKKKEDVERMAEANR 149
Cdd:PRK04027 140 LALRFIAEGARQasfKNKKSIEEALAEEIIAAANNdpKSYAVRKKEEIERVAKSAR 195
S7_S5_E_A TIGR01028
ribosomal protein S7(archaeal)/S5(eukaryotic); This model describes the members from the ...
22-149 1.27e-21

ribosomal protein S7(archaeal)/S5(eukaryotic); This model describes the members from the eukaryotic cytosol and the Archaea of the family that includes ribosomal protein S7 of bacteria and S5 of eukaryotes. A separate model describes bacterial and organellar S7 [Protein synthesis, Ribosomal proteins: synthesis and modification].


Pssm-ID: 211618  Cd Length: 186  Bit Score: 86.74  E-value: 1.27e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G          22 LVTAFINKIMR----DGKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQ 97
Cdd:TIGR01028  50 IVERLINKVMRsgrnNGKKLKAYRIVKEAFEIIEKRTGENPIQVLVDAIENAGPREDTTRIGYGGIVYRQAVDISPLRRV 129
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*..
2XG1G          98 SLALRWLVQAANQ---RPERRAAVRIAHELMDAAEG--KGGAVKKKEDVERMAEANR 149
Cdd:TIGR01028 130 DQALRNIALGAREaafRNKKSIAECLAEEIILAANGdsKSYAIKKKEELERVAKSAR 186
PTZ00091 PTZ00091
40S ribosomal protein S5; Provisional
34-149 7.00e-15

40S ribosomal protein S5; Provisional


Pssm-ID: 185439  Cd Length: 193  Bit Score: 67.87  E-value: 7.00e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1G         34 GKKNLAARIFYDACKIIQEKTGQEPLKVFKQAVENVKPRMEvrSRRVG--GANYQVPMEVSPRRQQSLALRWLVQAAnqr 111
Cdd:PTZ00091  73 GKKLLAVRIVKHAFEIIHLLTDKNPLQVLVDAVQNGGPRED--STRVGsgGVVRRQAVDVSPLRRVNQAIYLICKGA--- 147
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
2XG1G        112 peRRAAVR--------IAHELMDAAEG--KGGAVKKKEDVERMAEANR 149
Cdd:PTZ00091 148 --REAAFRniktiaecLADEIINASKEssNSYAIKKKDEVERVAKANR 193
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH