NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307568016|pdb|2XG0W| ]
View 

Chain W, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The 70s Ribosome (part 2 Of 4)

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ribosomal_L22 cd00336
Ribosomal protein L22/L17e. L22 (L17 in eukaryotes) is a core protein of the large ribosomal ...
3-107 6.21e-45

Ribosomal protein L22/L17e. L22 (L17 in eukaryotes) is a core protein of the large ribosomal subunit. It is the only ribosomal protein that interacts with all six domains of 23S rRNA, and is one of the proteins important for directing the proper folding and stabilizing the conformation of 23S rRNA. L22 is the largest protein contributor to the surface of the polypeptide exit channel, the tunnel through which the polypeptide product passes. L22 is also one of six proteins located at the putative translocon binding site on the exterior surface of the ribosome.


:

Pssm-ID: 238205  Cd Length: 105  Bit Score: 143.40  E-value: 6.21e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W         3 AKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPAL 82
Cdd:cd00336   1 AKAKGRYLRISPKKARLVARLIRGMSVDEALAQLEFVPKKAAKIILKLLKSAEANAENNGLDDPDKLYIKHIQVNKGPTL 80
                        90       100
                ....*....|....*....|....*
2XG0W        83 KRVLPRARGRADIIKKRTSHITVIL 107
Cdd:cd00336  81 KRRRPRARGRANPIRKRTCHITVVL 105
 
Name Accession Description Interval E-value
Ribosomal_L22 cd00336
Ribosomal protein L22/L17e. L22 (L17 in eukaryotes) is a core protein of the large ribosomal ...
3-107 6.21e-45

Ribosomal protein L22/L17e. L22 (L17 in eukaryotes) is a core protein of the large ribosomal subunit. It is the only ribosomal protein that interacts with all six domains of 23S rRNA, and is one of the proteins important for directing the proper folding and stabilizing the conformation of 23S rRNA. L22 is the largest protein contributor to the surface of the polypeptide exit channel, the tunnel through which the polypeptide product passes. L22 is also one of six proteins located at the putative translocon binding site on the exterior surface of the ribosome.


Pssm-ID: 238205  Cd Length: 105  Bit Score: 143.40  E-value: 6.21e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W         3 AKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPAL 82
Cdd:cd00336   1 AKAKGRYLRISPKKARLVARLIRGMSVDEALAQLEFVPKKAAKIILKLLKSAEANAENNGLDDPDKLYIKHIQVNKGPTL 80
                        90       100
                ....*....|....*....|....*
2XG0W        83 KRVLPRARGRADIIKKRTSHITVIL 107
Cdd:cd00336  81 KRRRPRARGRANPIRKRTCHITVVL 105
rplV PRK00565
50S ribosomal protein L22; Reviewed
1-110 9.49e-61

50S ribosomal protein L22; Reviewed


Pssm-ID: 234793  Cd Length: 112  Bit Score: 183.76  E-value: 9.49e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W          1 MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGP 80
Cdd:PRK00565   1 MEAKAKARYVRVSPRKARLVADLIRGKKVEEALAILKFSPKKAARLVKKVLKSAIANAENNHGLDIDNLVVKEAYVDEGP 80
                         90       100       110
                 ....*....|....*....|....*....|
2XG0W         81 ALKRVLPRARGRADIIKKRTSHITVILGEK 110
Cdd:PRK00565  81 TLKRFRPRARGRASRIRKRTSHITVVVAEK 110
RplV COG0091
Ribosomal protein L22 [Translation, ribosomal structure and biogenesis]
1-110 3.59e-49

Ribosomal protein L22 [Translation, ribosomal structure and biogenesis]


Pssm-ID: 223169  Cd Length: 120  Bit Score: 154.73  E-value: 3.59e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W         1 MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGP 80
Cdd:COG0091   9 MEAKAKARYLRISPKKARLVADLIRGKKVAEALAILEFVPKKAAKLVKKVLESAIANAENNKGLDPDKLVVSHIAVDKGP 88
                        90       100       110
                ....*....|....*....|....*....|
2XG0W        81 ALKRVLPRARGRADIIKKRTSHITVILGEK 110
Cdd:COG0091  89 VLKRFMPRARGRATRINKRTSHITVVVREK 118
Ribosomal_L22 pfam00237
Ribosomal protein L22p/L17e; This family includes L22 from prokaryotes and chloroplasts and ...
5-109 4.77e-49

Ribosomal protein L22p/L17e; This family includes L22 from prokaryotes and chloroplasts and L17 from eukaryotes.


Pssm-ID: 249705  Cd Length: 105  Bit Score: 153.79  E-value: 4.77e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W           5 AIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPALKR 84
Cdd:pfam00237   1 AVARYIRISPKKARLVADLIRGKSVEEALAILEFVPKKAAKIILKLLKSAVANAENNKGLDPDNLYIKEIFVDKGPTLKR 80
                          90       100
                  ....*....|....*....|....*
2XG0W          85 VLPRARGRADIIKKRTSHITVILGE 109
Cdd:pfam00237  81 FRPRARGRATPIRKRTSHITIVLSE 105
rplV_bact TIGR01044
ribosomal protein L22, bacterial type; This model decribes bacterial and chloroplast ribosomal ...
5-107 1.39e-37

ribosomal protein L22, bacterial type; This model decribes bacterial and chloroplast ribosomal protein L22 [Protein synthesis, Ribosomal proteins: synthesis and modification].


Pssm-ID: 130116  Cd Length: 103  Bit Score: 124.55  E-value: 1.39e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W           5 AIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPALKR 84
Cdd:TIGR01044   1 AKARFVRISPRKARLVADLIRGKSVSQALDILRFTPKKAAPLIKKVLASAIANAEHNYGLDADNLVVVTIFVDEGPTLKR 80
                          90       100
                  ....*....|....*....|...
2XG0W          85 VLPRARGRADIIKKRTSHITVIL 107
Cdd:TIGR01044  81 IRPRAKGRASRIRKRTSHITVVV 103
rpl22 CHL00034
ribosomal protein L22
2-110 4.05e-37

ribosomal protein L22


Pssm-ID: 214342  Cd Length: 117  Bit Score: 123.50  E-value: 4.05e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W          2 EAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPA 81
Cdd:CHL00034   9 EVYALAKYIRMSAHKARRVIDQIRGRSYEEALMILEFMPYRACYPILKLVYSAAANASHNMGLNKANLFISKAEVDEGPT 88
                         90       100
                 ....*....|....*....|....*....
2XG0W         82 LKRVLPRARGRADIIKKRTSHITVILGEK 110
Cdd:CHL00034  89 LKRFRPRAQGRSYPIKKPTCHITIVLKDI 117
PTZ00178 PTZ00178
60S ribosomal protein L17; Provisional
3-110 1.02e-03

60S ribosomal protein L17; Provisional


Pssm-ID: 240306  Cd Length: 181  Bit Score: 35.43  E-value: 1.02e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W          3 AKAIARYVRISPRKVRLVVDLIRGKSLEEARNIL-------------RYTNKRG-------------------AYFVAKV 50
Cdd:PTZ00178  15 AKAKGSDLRVHFKNTYETARAIKGMKLARAQKYLedvlakkrcvpfrRFNGGVGrtaqakefghtqgrwpeksVKFVLSL 94
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
2XG0W         51 LESAAANA-VNNHDmlEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGEK 110
Cdd:PTZ00178  95 LKNAEANAeAKGLD--VEKLVISHVQVNRAPRGRRRTYRAHGRINPFMSSPCHIELIATEK 153
PRK12279 PRK12279
50S ribosomal protein L22/unknown domain fusion protein; Provisional
1-109 6.68e-33

50S ribosomal protein L22/unknown domain fusion protein; Provisional


Pssm-ID: 138835 [Multi-domain]  Cd Length: 311  Bit Score: 117.48  E-value: 6.68e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W          1 MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAV-NNHDMLEDRLYVKAAYVDEG 79
Cdd:PRK12279   1 MTNKVIQRNIHISHRKASLVIDLVRNKPVHEAIRILSNTPKKFAPIVLKLLNSAISNVQhNSKDMDPSKLYIYKIVANQG 80
                         90       100       110
                 ....*....|....*....|....*....|
2XG0W         80 PALKRVLPRARGRADIIKKRTSHITVILGE 109
Cdd:PRK12279  81 PTMKRTLPRAKGSADQLFKRTTHLEIVLSD 110
 
Name Accession Description Interval E-value
Ribosomal_L22 cd00336
Ribosomal protein L22/L17e. L22 (L17 in eukaryotes) is a core protein of the large ribosomal ...
3-107 6.21e-45

Ribosomal protein L22/L17e. L22 (L17 in eukaryotes) is a core protein of the large ribosomal subunit. It is the only ribosomal protein that interacts with all six domains of 23S rRNA, and is one of the proteins important for directing the proper folding and stabilizing the conformation of 23S rRNA. L22 is the largest protein contributor to the surface of the polypeptide exit channel, the tunnel through which the polypeptide product passes. L22 is also one of six proteins located at the putative translocon binding site on the exterior surface of the ribosome.


Pssm-ID: 238205  Cd Length: 105  Bit Score: 143.40  E-value: 6.21e-45
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W         3 AKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPAL 82
Cdd:cd00336   1 AKAKGRYLRISPKKARLVARLIRGMSVDEALAQLEFVPKKAAKIILKLLKSAEANAENNGLDDPDKLYIKHIQVNKGPTL 80
                        90       100
                ....*....|....*....|....*
2XG0W        83 KRVLPRARGRADIIKKRTSHITVIL 107
Cdd:cd00336  81 KRRRPRARGRANPIRKRTCHITVVL 105
rplV PRK00565
50S ribosomal protein L22; Reviewed
1-110 9.49e-61

50S ribosomal protein L22; Reviewed


Pssm-ID: 234793  Cd Length: 112  Bit Score: 183.76  E-value: 9.49e-61
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W          1 MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGP 80
Cdd:PRK00565   1 MEAKAKARYVRVSPRKARLVADLIRGKKVEEALAILKFSPKKAARLVKKVLKSAIANAENNHGLDIDNLVVKEAYVDEGP 80
                         90       100       110
                 ....*....|....*....|....*....|
2XG0W         81 ALKRVLPRARGRADIIKKRTSHITVILGEK 110
Cdd:PRK00565  81 TLKRFRPRARGRASRIRKRTSHITVVVAEK 110
RplV COG0091
Ribosomal protein L22 [Translation, ribosomal structure and biogenesis]
1-110 3.59e-49

Ribosomal protein L22 [Translation, ribosomal structure and biogenesis]


Pssm-ID: 223169  Cd Length: 120  Bit Score: 154.73  E-value: 3.59e-49
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W         1 MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGP 80
Cdd:COG0091   9 MEAKAKARYLRISPKKARLVADLIRGKKVAEALAILEFVPKKAAKLVKKVLESAIANAENNKGLDPDKLVVSHIAVDKGP 88
                        90       100       110
                ....*....|....*....|....*....|
2XG0W        81 ALKRVLPRARGRADIIKKRTSHITVILGEK 110
Cdd:COG0091  89 VLKRFMPRARGRATRINKRTSHITVVVREK 118
Ribosomal_L22 pfam00237
Ribosomal protein L22p/L17e; This family includes L22 from prokaryotes and chloroplasts and ...
5-109 4.77e-49

Ribosomal protein L22p/L17e; This family includes L22 from prokaryotes and chloroplasts and L17 from eukaryotes.


Pssm-ID: 249705  Cd Length: 105  Bit Score: 153.79  E-value: 4.77e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W           5 AIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPALKR 84
Cdd:pfam00237   1 AVARYIRISPKKARLVADLIRGKSVEEALAILEFVPKKAAKIILKLLKSAVANAENNKGLDPDNLYIKEIFVDKGPTLKR 80
                          90       100
                  ....*....|....*....|....*
2XG0W          85 VLPRARGRADIIKKRTSHITVILGE 109
Cdd:pfam00237  81 FRPRARGRATPIRKRTSHITIVLSE 105
rplV_bact TIGR01044
ribosomal protein L22, bacterial type; This model decribes bacterial and chloroplast ribosomal ...
5-107 1.39e-37

ribosomal protein L22, bacterial type; This model decribes bacterial and chloroplast ribosomal protein L22 [Protein synthesis, Ribosomal proteins: synthesis and modification].


Pssm-ID: 130116  Cd Length: 103  Bit Score: 124.55  E-value: 1.39e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W           5 AIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPALKR 84
Cdd:TIGR01044   1 AKARFVRISPRKARLVADLIRGKSVSQALDILRFTPKKAAPLIKKVLASAIANAEHNYGLDADNLVVVTIFVDEGPTLKR 80
                          90       100
                  ....*....|....*....|...
2XG0W          85 VLPRARGRADIIKKRTSHITVIL 107
Cdd:TIGR01044  81 IRPRAKGRASRIRKRTSHITVVV 103
rpl22 CHL00034
ribosomal protein L22
2-110 4.05e-37

ribosomal protein L22


Pssm-ID: 214342  Cd Length: 117  Bit Score: 123.50  E-value: 4.05e-37
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W          2 EAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAVNNHDMLEDRLYVKAAYVDEGPA 81
Cdd:CHL00034   9 EVYALAKYIRMSAHKARRVIDQIRGRSYEEALMILEFMPYRACYPILKLVYSAAANASHNMGLNKANLFISKAEVDEGPT 88
                         90       100
                 ....*....|....*....|....*....
2XG0W         82 LKRVLPRARGRADIIKKRTSHITVILGEK 110
Cdd:CHL00034  89 LKRFRPRAQGRSYPIKKPTCHITIVLKDI 117
rpl22p PRK04223
50S ribosomal protein L22P; Reviewed
3-109 3.71e-14

50S ribosomal protein L22P; Reviewed


Pssm-ID: 179794  Cd Length: 153  Bit Score: 64.11  E-value: 3.71e-14
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W          3 AKAIARYVRISPRKVRLVVDLIRGKSLEEARNIL-------------------------------RYTNKRGAYFVaKVL 51
Cdd:PRK04223  16 AKAMGRELPISPKHSVEIAREIRGMKLDEAKAYLedvialkravpfkrhnkkvghrkgidgwpagRYPVKAAKAFL-KLL 94
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
2XG0W         52 ESAAANAvNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGE 109
Cdd:PRK04223  95 ENAEANA-EYKGLDTEKLVIVHIAAHKGRVIKGYMPRAFGRATPKNTETVNIEVILEE 151
L22_arch TIGR01038
ribosomal protein L22(archaeal)/L17(eukaryotic/archaeal); This model describes the ribosomal ...
3-110 4.62e-13

ribosomal protein L22(archaeal)/L17(eukaryotic/archaeal); This model describes the ribosomal protein of the eukaryotic cytosol and of the Archaea, variously designated as L17, L22, and L23. The corresponding bacterial homolog, described by a separate model, is designated L22 [Protein synthesis, Ribosomal proteins: synthesis and modification].


Pssm-ID: 211620  Cd Length: 150  Bit Score: 60.94  E-value: 4.62e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W           3 AKAIARYVRISPRKVRLVVDLIRGKSLEEARNIL-------------RYTNKRG-------------------AYFVAKV 50
Cdd:TIGR01038  12 AKARGRNLRVSFKNARETARAIRGMELDKARKYLedviemkravpfrRYNGKVGhrrglkewgwtagrypvkaAKFILKV 91
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W          51 LESAAANAvNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGEK 110
Cdd:TIGR01038  92 LQNAEANA-EYKGLDVEKLVIIHIQANKGPKIRRWMPRAFGRATPYNSSPTHIELVVEEK 150
PTZ00178 PTZ00178
60S ribosomal protein L17; Provisional
3-110 1.02e-03

60S ribosomal protein L17; Provisional


Pssm-ID: 240306  Cd Length: 181  Bit Score: 35.43  E-value: 1.02e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W          3 AKAIARYVRISPRKVRLVVDLIRGKSLEEARNIL-------------RYTNKRG-------------------AYFVAKV 50
Cdd:PTZ00178  15 AKAKGSDLRVHFKNTYETARAIKGMKLARAQKYLedvlakkrcvpfrRFNGGVGrtaqakefghtqgrwpeksVKFVLSL 94
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
2XG0W         51 LESAAANA-VNNHDmlEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRTSHITVILGEK 110
Cdd:PTZ00178  95 LKNAEANAeAKGLD--VEKLVISHVQVNRAPRGRRRTYRAHGRINPFMSSPCHIELIATEK 153
PRK12279 PRK12279
50S ribosomal protein L22/unknown domain fusion protein; Provisional
1-109 6.68e-33

50S ribosomal protein L22/unknown domain fusion protein; Provisional


Pssm-ID: 138835 [Multi-domain]  Cd Length: 311  Bit Score: 117.48  E-value: 6.68e-33
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0W          1 MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKVLESAAANAV-NNHDMLEDRLYVKAAYVDEG 79
Cdd:PRK12279   1 MTNKVIQRNIHISHRKASLVIDLVRNKPVHEAIRILSNTPKKFAPIVLKLLNSAISNVQhNSKDMDPSKLYIYKIVANQG 80
                         90       100       110
                 ....*....|....*....|....*....|
2XG0W         80 PALKRVLPRARGRADIIKKRTSHITVILGE 109
Cdd:PRK12279  81 PTMKRTLPRAKGSADQLFKRTTHLEIVLSD 110
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH