NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|29832108|ref|NP_826742|]
View 

magnesium or manganese-dependent protein phosphatase [Streptomyces avermitilis MA-4680 = NBRC 14893]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
513-727 2.77e-40

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 146.67  E-value: 2.77e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108   513 GDGRWCFAVGDVQGKGPEAAVVIGLARPWLRLLAREGYQVADVLDRLNQLLlddateaadaaaralvaaggpglgADEGP 592
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRAL------------------------QRNLE 56
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108   593 QNRFLSLLYGELVPFEGgvRCTLASAGHPLPLLLTPDGDVR-PVAQPQTLLGVVEDATYTCETFELHPADTLLCVTDGVT 671
Cdd:pfam07228  57 GERFATAVLAVYDPETG--TLEYANAGHPPPLLLRPDGGVVeLLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLT 134
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 29832108   672 ERRSGSHQFDDGDGLAAALAGCAGLSAELIAERIRRLVHEFGARPPEDDLALLVLQ 727
Cdd:pfam07228 135 EARDPDGELFGLERLLALLAERHGLSPEELLDALLEDLLRLGGGELEDDITLLVLR 190
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
46-176 3.89e-08

Histidine kinase-like ATPase domain;


:

Pssm-ID: 257897  Cd Length: 126  Bit Score: 52.25  E-value: 3.89e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108    46 AARRFVREALAdwaelglsgAASLPGRLSDDAVVVVSELVTNAVVHA-----GTDVDLVCRIDeseeePAGLVVEVSDRh 120
Cdd:pfam13581  10 AARRFVAAFLA---------RAGLSEERLEEIELAVEEALTNAVEHAyredpGGPVRVRLEID-----GDGLVVEVRDS- 74
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 29832108   121 pSRAVRDEAAGHPYGTAAAERPYGtpeyGRGLRLVSALSEAWGITYRTGAKTVWAR 176
Cdd:pfam13581  75 -GPGFDPLELPDPDLTEPDDLPEG----GRGLFLIRQLMDEVEYERGDGGNVLRLT 125
GAF_3 pfam13492
GAF domain;
334-457 2.74e-05

GAF domain;


:

Pssm-ID: 257816  Cd Length: 129  Bit Score: 43.20  E-value: 2.74e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108   334 ADWCAVWLEDEATGWRGPETGMAPGPRLARVWHGSENRIedlRRALERHPPRLPESVRTRPVPApwpaealgphgaSGSA 413
Cdd:pfam13492  19 ADRAALYLLDEDGLELRLVAGSGGEPRLSESLPEDSPLA---QRALEKGEPVSVPAGDNRDLLP------------SESL 83
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
gi 29832108   414 LAYRLIAGGRPLGTLVIGRAGLLRYPDEITGLVEDLSRRVALAI 457
Cdd:pfam13492  84 LAVPLRAGGEVIGVLVLESTPEEAFTPEDLELLELLASQIAIAL 127
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
513-727 2.77e-40

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 146.67  E-value: 2.77e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108   513 GDGRWCFAVGDVQGKGPEAAVVIGLARPWLRLLAREGYQVADVLDRLNQLLlddateaadaaaralvaaggpglgADEGP 592
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRAL------------------------QRNLE 56
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108   593 QNRFLSLLYGELVPFEGgvRCTLASAGHPLPLLLTPDGDVR-PVAQPQTLLGVVEDATYTCETFELHPADTLLCVTDGVT 671
Cdd:pfam07228  57 GERFATAVLAVYDPETG--TLEYANAGHPPPLLLRPDGGVVeLLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLT 134
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 29832108   672 ERRSGSHQFDDGDGLAAALAGCAGLSAELIAERIRRLVHEFGARPPEDDLALLVLQ 727
Cdd:pfam07228 135 EARDPDGELFGLERLLALLAERHGLSPEELLDALLEDLLRLGGGELEDDITLLVLR 190
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
503-676 3.59e-26

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 106.66  E-value: 3.59e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108    503 SGDFYDLFPAGDGRWCFAVGDVQGKGPEAAVVIGLARPWLRLLAREGYQVADVLDRLNQLLLddateaadaaaralvaag 582
Cdd:smart00331  17 GGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIY------------------ 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108    583 gpglgaDEGPQNRFLSLLYGELVPFEGGVRctLASAGHPLPLLLTPDGD-VRPVAQPQTLLGVVEDATYTCETFELHPAD 661
Cdd:smart00331  79 ------ENGEDGMFATLFLALYDFAGGTLS--YANAGHSPPYLLRADGGlVEDLDDLGAPLGLEPDVEVDVRELTLEPGD 150
                          170
                   ....*....|....*
gi 29832108    662 TLLCVTDGVTERRSG 676
Cdd:smart00331 151 LLLLYTDGLTEARNP 165
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
46-176 3.89e-08

Histidine kinase-like ATPase domain;


Pssm-ID: 257897  Cd Length: 126  Bit Score: 52.25  E-value: 3.89e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108    46 AARRFVREALAdwaelglsgAASLPGRLSDDAVVVVSELVTNAVVHA-----GTDVDLVCRIDeseeePAGLVVEVSDRh 120
Cdd:pfam13581  10 AARRFVAAFLA---------RAGLSEERLEEIELAVEEALTNAVEHAyredpGGPVRVRLEID-----GDGLVVEVRDS- 74
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 29832108   121 pSRAVRDEAAGHPYGTAAAERPYGtpeyGRGLRLVSALSEAWGITYRTGAKTVWAR 176
Cdd:pfam13581  75 -GPGFDPLELPDPDLTEPDDLPEG----GRGLFLIRQLMDEVEYERGDGGNVLRLT 125
RsbW COG2172
Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]
47-158 3.37e-06

Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]


Pssm-ID: 225083  Cd Length: 146  Bit Score: 46.21  E-value: 3.37e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108  47 ARRFVREALADWAELglsgaASLPGRLSDDAVVVVSELVTNAVVHAG-TDVDLVCRIDESEEEPAGLVVEVSDRHPSRAV 125
Cdd:COG2172  16 AVGTARLTLREFARE-----LGLTYVDIADLAIAVSEALTNAVKHAYkLDPSEGEIRIEVSLDDGKLEIRIWDQGPGIED 90
                        90       100       110
                ....*....|....*....|....*....|...
gi 29832108 126 RDEAAGHPYGTAAAERpygtpEYGRGLRLVSAL 158
Cdd:COG2172  91 LEESLGPGDTTAEGLQ-----EGGLGLFLAKRL 118
GAF_3 pfam13492
GAF domain;
334-457 2.74e-05

GAF domain;


Pssm-ID: 257816  Cd Length: 129  Bit Score: 43.20  E-value: 2.74e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108   334 ADWCAVWLEDEATGWRGPETGMAPGPRLARVWHGSENRIedlRRALERHPPRLPESVRTRPVPApwpaealgphgaSGSA 413
Cdd:pfam13492  19 ADRAALYLLDEDGLELRLVAGSGGEPRLSESLPEDSPLA---QRALEKGEPVSVPAGDNRDLLP------------SESL 83
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
gi 29832108   414 LAYRLIAGGRPLGTLVIGRAGLLRYPDEITGLVEDLSRRVALAI 457
Cdd:pfam13492  84 LAVPLRAGGEVIGVLVLESTPEEAFTPEDLELLELLASQIAIAL 127
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
321-465 1.83e-04

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


Pssm-ID: 214500  Cd Length: 149  Bit Score: 41.21  E-value: 1.83e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108    321 VAALAGQLLVprlADWCAVWLEDEaTGWRGPETGMAPGPRLARvwHGSENRIED--LRRALERHPPRLpeSVRTRPVPaP 398
Cdd:smart00065   9 ILEELRQLLG---ADRVLIYLVDE-NDRGELVLVAADGLTLPT--LGIRFPLDEglAGRVAETGRPLN--IPDVEADP-L 79
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 29832108    399 WPAEALGPHGASGSALAYRLIAGGRPLGTLVIGRAGLLR--YPDEITgLVEDLSRRVALAIGAARQYAR 465
Cdd:smart00065  80 FAEDLLGRYQGVRSFLAVPLVADGELVGVLALHNKKSPRpfTEEDEE-LLQALANQLAIALANAQLYEE 147
FhlA COG2203
FOG: GAF domain [Signal transduction mechanisms]
305-467 1.84e-03

FOG: GAF domain [Signal transduction mechanisms]


Pssm-ID: 225113  Cd Length: 175  Bit Score: 38.80  E-value: 1.84e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108 305 LAEASDLLAGQLDEDLVAALAGQLLVPRL-ADWCAVWLEDEATGWRGPETGmAPGPRLARVWHGSENRIEDLRRALERHP 383
Cdd:COG2203   6 LNELAAKIAQDLDLEEILQAALELLAELLgADRGLIYLLDEDGLLDGALVA-EAAEAGLEQLIDELFGLVILPACLIGIA 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108 384 PRLPESVRTRPV---PAPWPAEALGPHGASGSALAYRLIAGGRPLGTLVIGRAGLLR-YPDEITGLVEDLSRRVALAIGA 459
Cdd:COG2203  85 LREGRPVVVEDIlqdPRFRDNPLVLLEPPIRSYLGVPLIAQGELLGLLCVHDSEPRRqWSEEELELLEELAEQVAIAIER 164

                ....*...
gi 29832108 460 ARQYARQA 467
Cdd:COG2203 165 ARLYEELQ 172
HATPase_c smart00387
Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
80-179 2.93e-03

Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.


Pssm-ID: 214643  Cd Length: 111  Bit Score: 36.86  E-value: 2.93e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108     80 VVSELVTNAVVHAGTDVDLVCRIDESEEEpagLVVEVSD--RHPSRAVRDEaAGHPYGTaAAERPYGTPEYGRGLRLVSA 157
Cdd:smart00387   9 VLSNLLDNAIKYTPEGGRITVTLERDGDH---VEITVEDngPGIPPEDLEK-IFEPFFR-TDKRSRKIGGTGLGLSIVKK 83
                           90       100
                   ....*....|....*....|....*..
gi 29832108    158 LSEAWG--ITYRTGAK---TVWARLPV 179
Cdd:smart00387  84 LVELHGgeISVESEPGggtTFTITLPL 110
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
451-727 1.84e-23

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 101.71  E-value: 1.84e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108 451 RRVALAIGAARQYARQ-------ATISRVLQRGLLPGAVAEIPGVRSALVYEPLDKGGpsGDFYDLFPAGDGRWCFAVGD 523
Cdd:COG2208 105 RAVGLVSAHNELLLLEqnnisaeLEVARQIQQNLLPKALPLFPGIDIEAILVPASEVG--GDYYDFIQLGEKRLRIGIGD 182
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108 524 VQGKGPEAAVVIGLARPWLRLLAREG-YQVADVLDRLNQLLLDDAteaadaaaralvaaggpglgadegPQNRFLSLLYG 602
Cdd:COG2208 183 VSGKGVPAALLMLMPKLALRLLLESGpLDPADVLETLNRVLKQNL------------------------EEDMFVTLFLG 238
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108 603 ELVPFEGgvRCTLASAGHPLPLLLTPDGD--VRPVAQPQTLLGVVEDATYTCETFELHPADTLLCVTDGVTERRSGSHQF 680
Cdd:COG2208 239 VYDLDSG--ELTYSNAGHEPALILSADGEieVEDLTALGLPIGLLPDYQYEVASLQLEPGDLLVLYTDGVTEARNSDGEF 316
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*...
gi 29832108 681 DDGDGLAAALAGCAGLSAELIAERIRRLVHEF-GARPPEDDLALLVLQ 727
Cdd:COG2208 317 FGLERLLKILGRLLGQPAEEILEAILESLEELqGDQIQDDDITLLVLK 364
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
513-727 2.77e-40

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 146.67  E-value: 2.77e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108   513 GDGRWCFAVGDVQGKGPEAAVVIGLARPWLRLLAREGYQVADVLDRLNQLLlddateaadaaaralvaaggpglgADEGP 592
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRAL------------------------QRNLE 56
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108   593 QNRFLSLLYGELVPFEGgvRCTLASAGHPLPLLLTPDGDVR-PVAQPQTLLGVVEDATYTCETFELHPADTLLCVTDGVT 671
Cdd:pfam07228  57 GERFATAVLAVYDPETG--TLEYANAGHPPPLLLRPDGGVVeLLESPGLPLGVLPDAPYETAEFPLEPGDTLLLYTDGLT 134
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 29832108   672 ERRSGSHQFDDGDGLAAALAGCAGLSAELIAERIRRLVHEFGARPPEDDLALLVLQ 727
Cdd:pfam07228 135 EARDPDGELFGLERLLALLAERHGLSPEELLDALLEDLLRLGGGELEDDITLLVLR 190
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
503-676 3.59e-26

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 106.66  E-value: 3.59e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108    503 SGDFYDLFPAGDGRWCFAVGDVQGKGPEAAVVIGLARPWLRLLAREGYQVADVLDRLNQLLLddateaadaaaralvaag 582
Cdd:smart00331  17 GGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIY------------------ 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108    583 gpglgaDEGPQNRFLSLLYGELVPFEGGVRctLASAGHPLPLLLTPDGD-VRPVAQPQTLLGVVEDATYTCETFELHPAD 661
Cdd:smart00331  79 ------ENGEDGMFATLFLALYDFAGGTLS--YANAGHSPPYLLRADGGlVEDLDDLGAPLGLEPDVEVDVRELTLEPGD 150
                          170
                   ....*....|....*
gi 29832108    662 TLLCVTDGVTERRSG 676
Cdd:smart00331 151 LLLLYTDGLTEARNP 165
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
46-176 3.89e-08

Histidine kinase-like ATPase domain;


Pssm-ID: 257897  Cd Length: 126  Bit Score: 52.25  E-value: 3.89e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108    46 AARRFVREALAdwaelglsgAASLPGRLSDDAVVVVSELVTNAVVHA-----GTDVDLVCRIDeseeePAGLVVEVSDRh 120
Cdd:pfam13581  10 AARRFVAAFLA---------RAGLSEERLEEIELAVEEALTNAVEHAyredpGGPVRVRLEID-----GDGLVVEVRDS- 74
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 29832108   121 pSRAVRDEAAGHPYGTAAAERPYGtpeyGRGLRLVSALSEAWGITYRTGAKTVWAR 176
Cdd:pfam13581  75 -GPGFDPLELPDPDLTEPDDLPEG----GRGLFLIRQLMDEVEYERGDGGNVLRLT 125
HATPase_c pfam02518
Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the ...
80-180 8.07e-07

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.


Pssm-ID: 251347  Cd Length: 111  Bit Score: 48.08  E-value: 8.07e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108    80 VVSELVTNAVVHAGTDVDLVCRIdesEEEPAGLVVEVSDRHPSRAVRD-EAAGHPYGTAAAERpYGTPEYGRGLRLVSAL 158
Cdd:pfam02518   9 VLSNLLDNAIKHAPAGGEIEVTL---ERDGGRLRITVEDNGIGIPPEDlPKIFEPFFRTDGSR-SKVGGTGLGLSIVRKL 84
                          90       100
                  ....*....|....*....|....*..
gi 29832108   159 SEAWG--ITYRTGAK---TVWARLPVD 180
Cdd:pfam02518  85 VELHGgtITVESEPGggtTFTLTLPLE 111
RsbW COG2172
Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]
47-158 3.37e-06

Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]


Pssm-ID: 225083  Cd Length: 146  Bit Score: 46.21  E-value: 3.37e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108  47 ARRFVREALADWAELglsgaASLPGRLSDDAVVVVSELVTNAVVHAG-TDVDLVCRIDESEEEPAGLVVEVSDRHPSRAV 125
Cdd:COG2172  16 AVGTARLTLREFARE-----LGLTYVDIADLAIAVSEALTNAVKHAYkLDPSEGEIRIEVSLDDGKLEIRIWDQGPGIED 90
                        90       100       110
                ....*....|....*....|....*....|...
gi 29832108 126 RDEAAGHPYGTAAAERpygtpEYGRGLRLVSAL 158
Cdd:COG2172  91 LEESLGPGDTTAEGLQ-----EGGLGLFLAKRL 118
GAF_3 pfam13492
GAF domain;
334-457 2.74e-05

GAF domain;


Pssm-ID: 257816  Cd Length: 129  Bit Score: 43.20  E-value: 2.74e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108   334 ADWCAVWLEDEATGWRGPETGMAPGPRLARVWHGSENRIedlRRALERHPPRLPESVRTRPVPApwpaealgphgaSGSA 413
Cdd:pfam13492  19 ADRAALYLLDEDGLELRLVAGSGGEPRLSESLPEDSPLA---QRALEKGEPVSVPAGDNRDLLP------------SESL 83
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....
gi 29832108   414 LAYRLIAGGRPLGTLVIGRAGLLRYPDEITGLVEDLSRRVALAI 457
Cdd:pfam13492  84 LAVPLRAGGEVIGVLVLESTPEEAFTPEDLELLELLASQIAIAL 127
GAF smart00065
Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these ...
321-465 1.83e-04

Domain present in phytochromes and cGMP-specific phosphodiesterases; Mutations within these domains in PDE6B result in autosomal recessive inheritance of retinitis pigmentosa.


Pssm-ID: 214500  Cd Length: 149  Bit Score: 41.21  E-value: 1.83e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108    321 VAALAGQLLVprlADWCAVWLEDEaTGWRGPETGMAPGPRLARvwHGSENRIED--LRRALERHPPRLpeSVRTRPVPaP 398
Cdd:smart00065   9 ILEELRQLLG---ADRVLIYLVDE-NDRGELVLVAADGLTLPT--LGIRFPLDEglAGRVAETGRPLN--IPDVEADP-L 79
                           90       100       110       120       130       140
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 29832108    399 WPAEALGPHGASGSALAYRLIAGGRPLGTLVIGRAGLLR--YPDEITgLVEDLSRRVALAIGAARQYAR 465
Cdd:smart00065  80 FAEDLLGRYQGVRSFLAVPLVADGELVGVLALHNKKSPRpfTEEDEE-LLQALANQLAIALANAQLYEE 147
FhlA COG2203
FOG: GAF domain [Signal transduction mechanisms]
305-467 1.84e-03

FOG: GAF domain [Signal transduction mechanisms]


Pssm-ID: 225113  Cd Length: 175  Bit Score: 38.80  E-value: 1.84e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108 305 LAEASDLLAGQLDEDLVAALAGQLLVPRL-ADWCAVWLEDEATGWRGPETGmAPGPRLARVWHGSENRIEDLRRALERHP 383
Cdd:COG2203   6 LNELAAKIAQDLDLEEILQAALELLAELLgADRGLIYLLDEDGLLDGALVA-EAAEAGLEQLIDELFGLVILPACLIGIA 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108 384 PRLPESVRTRPV---PAPWPAEALGPHGASGSALAYRLIAGGRPLGTLVIGRAGLLR-YPDEITGLVEDLSRRVALAIGA 459
Cdd:COG2203  85 LREGRPVVVEDIlqdPRFRDNPLVLLEPPIRSYLGVPLIAQGELLGLLCVHDSEPRRqWSEEELELLEELAEQVAIAIER 164

                ....*...
gi 29832108 460 ARQYARQA 467
Cdd:COG2203 165 ARLYEELQ 172
GAF pfam01590
GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl ...
319-457 2.62e-03

GAF domain; This domain is present in cGMP-specific phosphodiesterases, adenylyl and guanylyl cyclases, phytochromes, FhlA and NifA. Adenylyl and guanylyl cyclases catalyse ATP and GTP to the second messengers cAMP and cGMP, respectively, these products up-regulating catalytic activity by binding to the regulatory GAF domain(s). The opposite hydrolysis reaction is catalysed by phosphodiesterase. cGMP-dependent 3',5'-cyclic phosphodiesterase catalyses the conversion of guanosine 3',5'-cyclic phosphate to guanosine 5'-phosphate. Here too, cGMP regulates catalytic activity by GAF-domain binding. Phytochromes are regulatory photoreceptors in plants and bacteria which exist in two thermally-stable states that are reversibly inter-convertible by light: the Pr state absorbs maximally in the red region of the spectrum, while the Pfr state absorbs maximally in the far-red region. This domain is also found in FhlA (formate hydrogen lyase transcriptional activator) and NifA, a transcriptional activator which is required for activation of most Nif operons which are directly involved in nitrogen fixation. NifA interacts with sigma-54.


Pssm-ID: 250726  Cd Length: 146  Bit Score: 37.56  E-value: 2.62e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108   319 DLVAALAGQLLvprLADWCAVWLEDEAT-----GWRGPETGMAPGPRLARVWHGSENRIEDLRRALERHPPRLPESVRTR 393
Cdd:pfam01590   7 QTILEELRELL---GADRVAIYLADADGlllylVAGDGLSDIPLAARGLPLGGGVVGEVIAGGNPIVVPDVQDDPRFRDL 83
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 29832108   394 PVPAPWPAEALGPHGAsGSALAYRLIAGGRPLGTLVIGRAGLLRYPDEITGLVEDLSRRVALAI 457
Cdd:pfam01590  84 TALASDLPHFLRGLGI-RSCLAVPLKGGGELIGVLVLHSTSPRAFTEEELELLQALADQVAIAL 146
HATPase_c smart00387
Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
80-179 2.93e-03

Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.


Pssm-ID: 214643  Cd Length: 111  Bit Score: 36.86  E-value: 2.93e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108     80 VVSELVTNAVVHAGTDVDLVCRIDESEEEpagLVVEVSD--RHPSRAVRDEaAGHPYGTaAAERPYGTPEYGRGLRLVSA 157
Cdd:smart00387   9 VLSNLLDNAIKYTPEGGRITVTLERDGDH---VEITVEDngPGIPPEDLEK-IFEPFFR-TDKRSRKIGGTGLGLSIVKK 83
                           90       100
                   ....*....|....*....|....*..
gi 29832108    158 LSEAWG--ITYRTGAK---TVWARLPV 179
Cdd:smart00387  84 LVELHGgeISVESEPGggtTFTITLPL 110
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
451-727 1.84e-23

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 101.71  E-value: 1.84e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108 451 RRVALAIGAARQYARQ-------ATISRVLQRGLLPGAVAEIPGVRSALVYEPLDKGGpsGDFYDLFPAGDGRWCFAVGD 523
Cdd:COG2208 105 RAVGLVSAHNELLLLEqnnisaeLEVARQIQQNLLPKALPLFPGIDIEAILVPASEVG--GDYYDFIQLGEKRLRIGIGD 182
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108 524 VQGKGPEAAVVIGLARPWLRLLAREG-YQVADVLDRLNQLLLDDAteaadaaaralvaaggpglgadegPQNRFLSLLYG 602
Cdd:COG2208 183 VSGKGVPAALLMLMPKLALRLLLESGpLDPADVLETLNRVLKQNL------------------------EEDMFVTLFLG 238
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29832108 603 ELVPFEGgvRCTLASAGHPLPLLLTPDGD--VRPVAQPQTLLGVVEDATYTCETFELHPADTLLCVTDGVTERRSGSHQF 680
Cdd:COG2208 239 VYDLDSG--ELTYSNAGHEPALILSADGEieVEDLTALGLPIGLLPDYQYEVASLQLEPGDLLVLYTDGVTEARNSDGEF 316
                       250       260       270       280
                ....*....|....*....|....*....|....*....|....*...
gi 29832108 681 DDGDGLAAALAGCAGLSAELIAERIRRLVHEF-GARPPEDDLALLVLQ 727
Cdd:COG2208 317 FGLERLLKILGRLLGQPAEEILEAILESLEELqGDQIQDDDITLLVLK 364
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH