NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|29830651|ref|NP_825285|]
View 

magnesium or manganese-dependent protein phosphatase [Streptomyces avermitilis MA-4680 = NBRC 14893]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
227-412 1.41e-49

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 170.55  E-value: 1.41e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651   227 GGGRTALVIGDVMGRGVRAAAVMGQLRTAVRAYARLDLPPHEVLQLLD-GLAAEIDANQIATCVYAVHDPNEGRLVYASA 305
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNrALQRNLEGERFATAVLAVYDPETGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651   306 GHLPILVRDDSGIVLRADEPTGPPLG-TGGWMHASGSVPLGPGSTAVLYTDGLVERRDQD--LDEGIAALSRALAGATGT 382
Cdd:pfam07228  81 GHPPPLLLRPDGGVVELLESPGLPLGvLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDgeLFGLERLLALLAERHGLS 160
                         170       180       190
                  ....*....|....*....|....*....|..
gi 29830651   383 PQVVCDRLVRSAGVTADH--DDDVAVLVLQHP 412
Cdd:pfam07228 161 PEELLDALLEDLLRLGGGelEDDITLLVLRVR 192
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
434-535 1.27e-07

Histidine kinase-like ATPase domain;


:

Pssm-ID: 257897  Cd Length: 126  Bit Score: 49.94  E-value: 1.27e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651   434 EAAPRARAFASGVLTSWRFPTELHDLGVLAASELVANSLQHG-----TPPMRLRLRRTDRRLIVEVTD---GDDHL---- 501
Cdd:pfam13581   6 EALRAARRFVAAFLARAGLSEERLEEIELAVEEALTNAVEHAyredpGGPVRVRLEIDGDGLVVEVRDsgpGFDPLelpd 85
                          90       100       110
                  ....*....|....*....|....*....|....
gi 29830651   502 PRRRRAEPADEAGRGIAIVATIASSWGSRRTPGG 535
Cdd:pfam13581  86 PDLTEPDDLPEGGRGLFLIRQLMDEVEYERGDGG 119
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
62-164 2.06e-06

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


:

Pssm-ID: 254806 [Multi-domain]  Cd Length: 110  Bit Score: 46.25  E-value: 2.06e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651    62 LDRVPALVALVhGPDHRIAYVNDAYTAAFGERP---VGEPARKGLPELDELGLLPLLDQVLRSSKSRTVKSRKTPGG--R 136
Cdd:pfam08448   1 LDSLPDALAVL-DPDGRVRYANAAAAELFGLPPeelLGKTLAELLPPEDAARLERALRRALEGEEPIDFLEELLLNGeeR 79
                          90       100
                  ....*....|....*....|....*...
gi 29830651   137 SYTFTCTPVDASEDKDGGVLVFAVDVTD 164
Cdd:pfam08448  80 HYELRLTPLRDPDGEVIGVLVISRDITE 107
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
227-412 1.41e-49

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 170.55  E-value: 1.41e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651   227 GGGRTALVIGDVMGRGVRAAAVMGQLRTAVRAYARLDLPPHEVLQLLD-GLAAEIDANQIATCVYAVHDPNEGRLVYASA 305
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNrALQRNLEGERFATAVLAVYDPETGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651   306 GHLPILVRDDSGIVLRADEPTGPPLG-TGGWMHASGSVPLGPGSTAVLYTDGLVERRDQD--LDEGIAALSRALAGATGT 382
Cdd:pfam07228  81 GHPPPLLLRPDGGVVELLESPGLPLGvLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDgeLFGLERLLALLAERHGLS 160
                         170       180       190
                  ....*....|....*....|....*....|..
gi 29830651   383 PQVVCDRLVRSAGVTADH--DDDVAVLVLQHP 412
Cdd:pfam07228 161 PEELLDALLEDLLRLGGGelEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
199-372 1.29e-36

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 134.40  E-value: 1.29e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651    199 DDLRIAATYQPGgteAAVGGDWYDVITLGGGRTALVIGDVMGRGVRAAAVMGQLRTAVRAYARLDLPPHEVLQLLDGLAA 278
Cdd:smart00331   2 DGGLIAQYYEDA---TQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIY 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651    279 E-IDANQIATCVYAVHDPNEGRLVYASAGH-LPILVRDDSGIVLRADEpTGPPLGTG-GWMHASGSVPLGPGSTAVLYTD 355
Cdd:smart00331  79 EnGEDGMFATLFLALYDFAGGTLSYANAGHsPPYLLRADGGLVEDLDD-LGAPLGLEpDVEVDVRELTLEPGDLLLLYTD 157
                          170
                   ....*....|....*...
gi 29830651    356 GLVE-RRDQDLDEGIAAL 372
Cdd:smart00331 158 GLTEaRNPERLEELLEEL 175
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
434-535 1.27e-07

Histidine kinase-like ATPase domain;


Pssm-ID: 257897  Cd Length: 126  Bit Score: 49.94  E-value: 1.27e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651   434 EAAPRARAFASGVLTSWRFPTELHDLGVLAASELVANSLQHG-----TPPMRLRLRRTDRRLIVEVTD---GDDHL---- 501
Cdd:pfam13581   6 EALRAARRFVAAFLARAGLSEERLEEIELAVEEALTNAVEHAyredpGGPVRVRLEIDGDGLVVEVRDsgpGFDPLelpd 85
                          90       100       110
                  ....*....|....*....|....*....|....
gi 29830651   502 PRRRRAEPADEAGRGIAIVATIASSWGSRRTPGG 535
Cdd:pfam13581  86 PDLTEPDDLPEGGRGLFLIRQLMDEVEYERGDGG 119
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
62-164 2.06e-06

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254806 [Multi-domain]  Cd Length: 110  Bit Score: 46.25  E-value: 2.06e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651    62 LDRVPALVALVhGPDHRIAYVNDAYTAAFGERP---VGEPARKGLPELDELGLLPLLDQVLRSSKSRTVKSRKTPGG--R 136
Cdd:pfam08448   1 LDSLPDALAVL-DPDGRVRYANAAAAELFGLPPeelLGKTLAELLPPEDAARLERALRRALEGEEPIDFLEELLLNGeeR 79
                          90       100
                  ....*....|....*....|....*...
gi 29830651   137 SYTFTCTPVDASEDKDGGVLVFAVDVTD 164
Cdd:pfam08448  80 HYELRLTPLRDPDGEVIGVLVISRDITE 107
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
181-411 5.43e-35

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 134.45  E-value: 5.43e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651 181 ETAVTLQRSLLPQELEEPDDLRIAATYQPggtEAAVGGDWYDVITLGGGRTALVIGDVMGRGVRAAAVMGQLRTAVRAYA 260
Cdd:COG2208 129 EVARQIQQNLLPKALPLFPGIDIEAILVP---ASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLL 205
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651 261 RLDLP-PHEVLQLLD-GLAAEIDANQIATCVYAVHDPNEGRLVYASAGHLPILVRDDSGIVLRAD-EPTGPPLGTG-GWM 336
Cdd:COG2208 206 ESGPLdPADVLETLNrVLKQNLEEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEIEVEDlTALGLPIGLLpDYQ 285
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651 337 HASGSVPLGPGSTAVLYTDGLVERRDQDLD-EGIAALSRALAGATG-TPQVVCDRLVRSAGVTAD---HDDDVAVLVLQH 411
Cdd:COG2208 286 YEVASLQLEPGDLLVLYTDGVTEARNSDGEfFGLERLLKILGRLLGqPAEEILEAILESLEELQGdqiQDDDITLLVLKV 365
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
227-412 1.41e-49

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 170.55  E-value: 1.41e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651   227 GGGRTALVIGDVMGRGVRAAAVMGQLRTAVRAYARLDLPPHEVLQLLD-GLAAEIDANQIATCVYAVHDPNEGRLVYASA 305
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNrALQRNLEGERFATAVLAVYDPETGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651   306 GHLPILVRDDSGIVLRADEPTGPPLG-TGGWMHASGSVPLGPGSTAVLYTDGLVERRDQD--LDEGIAALSRALAGATGT 382
Cdd:pfam07228  81 GHPPPLLLRPDGGVVELLESPGLPLGvLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDgeLFGLERLLALLAERHGLS 160
                         170       180       190
                  ....*....|....*....|....*....|..
gi 29830651   383 PQVVCDRLVRSAGVTADH--DDDVAVLVLQHP 412
Cdd:pfam07228 161 PEELLDALLEDLLRLGGGelEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
199-372 1.29e-36

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 134.40  E-value: 1.29e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651    199 DDLRIAATYQPGgteAAVGGDWYDVITLGGGRTALVIGDVMGRGVRAAAVMGQLRTAVRAYARLDLPPHEVLQLLDGLAA 278
Cdd:smart00331   2 DGGLIAQYYEDA---TQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIY 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651    279 E-IDANQIATCVYAVHDPNEGRLVYASAGH-LPILVRDDSGIVLRADEpTGPPLGTG-GWMHASGSVPLGPGSTAVLYTD 355
Cdd:smart00331  79 EnGEDGMFATLFLALYDFAGGTLSYANAGHsPPYLLRADGGLVEDLDD-LGAPLGLEpDVEVDVRELTLEPGDLLLLYTD 157
                          170
                   ....*....|....*...
gi 29830651    356 GLVE-RRDQDLDEGIAAL 372
Cdd:smart00331 158 GLTEaRNPERLEELLEEL 175
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
434-535 1.27e-07

Histidine kinase-like ATPase domain;


Pssm-ID: 257897  Cd Length: 126  Bit Score: 49.94  E-value: 1.27e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651   434 EAAPRARAFASGVLTSWRFPTELHDLGVLAASELVANSLQHG-----TPPMRLRLRRTDRRLIVEVTD---GDDHL---- 501
Cdd:pfam13581   6 EALRAARRFVAAFLARAGLSEERLEEIELAVEEALTNAVEHAyredpGGPVRVRLEIDGDGLVVEVRDsgpGFDPLelpd 85
                          90       100       110
                  ....*....|....*....|....*....|....
gi 29830651   502 PRRRRAEPADEAGRGIAIVATIASSWGSRRTPGG 535
Cdd:pfam13581  86 PDLTEPDDLPEGGRGLFLIRQLMDEVEYERGDGG 119
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
62-164 2.06e-06

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254806 [Multi-domain]  Cd Length: 110  Bit Score: 46.25  E-value: 2.06e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651    62 LDRVPALVALVhGPDHRIAYVNDAYTAAFGERP---VGEPARKGLPELDELGLLPLLDQVLRSSKSRTVKSRKTPGG--R 136
Cdd:pfam08448   1 LDSLPDALAVL-DPDGRVRYANAAAAELFGLPPeelLGKTLAELLPPEDAARLERALRRALEGEEPIDFLEELLLNGeeR 79
                          90       100
                  ....*....|....*....|....*...
gi 29830651   137 SYTFTCTPVDASEDKDGGVLVFAVDVTD 164
Cdd:pfam08448  80 HYELRLTPLRDPDGEVIGVLVISRDITE 107
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
181-411 5.43e-35

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 134.45  E-value: 5.43e-35
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651 181 ETAVTLQRSLLPQELEEPDDLRIAATYQPggtEAAVGGDWYDVITLGGGRTALVIGDVMGRGVRAAAVMGQLRTAVRAYA 260
Cdd:COG2208 129 EVARQIQQNLLPKALPLFPGIDIEAILVP---ASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLL 205
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651 261 RLDLP-PHEVLQLLD-GLAAEIDANQIATCVYAVHDPNEGRLVYASAGHLPILVRDDSGIVLRAD-EPTGPPLGTG-GWM 336
Cdd:COG2208 206 ESGPLdPADVLETLNrVLKQNLEEDMFVTLFLGVYDLDSGELTYSNAGHEPALILSADGEIEVEDlTALGLPIGLLpDYQ 285
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 29830651 337 HASGSVPLGPGSTAVLYTDGLVERRDQDLD-EGIAALSRALAGATG-TPQVVCDRLVRSAGVTAD---HDDDVAVLVLQH 411
Cdd:COG2208 286 YEVASLQLEPGDLLVLYTDGVTEARNSDGEfFGLERLLKILGRLLGqPAEEILEAILESLEELQGdqiQDDDITLLVLKV 365
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH