NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|297291543|ref|XP_001083841.2|]
View 

PREDICTED: protein-L-isoaspartate(D-aspartate) O-methyltransferase isoform 3 [Macaca mulatta]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
AdoMet_MTases cd02440
S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; ...
139-241 5.06e-07

S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).


:

Pssm-ID: 100107  Cd Length: 107  Bit Score: 46.65  E-value: 5.06e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 139 KALDVGSGSGILTACFARMVGCtgKVIGIDhikelVDDSINNVRKDDPTLLSSGRVQLVVGDGRMG-YAEEAPYDAIHVG 217
Cdd:cd02440    1 RVLDLGCGTGALALALASGPGA--RVTGVD-----ISPVALELARKAAAALLADNVEVLKGDAEELpPEADESFDVIISD 73
                         90       100       110
                 ....*....|....*....|....*....|.
gi 297291543 218 AAAPVV---PQALIDQ----LKPGGRLILPV 241
Cdd:cd02440   74 PPLHHLvedLARFLEEarrlLKPGGVLVLTL 104
PCMT pfam01135
Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT);
66-274 1.33e-110

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT);


:

Pssm-ID: 250389 [Multi-domain]  Cd Length: 205  Bit Score: 321.24  E-value: 1.33e-110
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543   66 ASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKC----NPYMDSPQSIGFQATISAPHMHAYALELLfdQLHEGAKAL 141
Cdd:pfam01135   1 NRNEALIENLKNYGVIKSDKVAEAMLAVDREEFVPEsfksYAYEDIPLSIGYGQTISAPHMHAMMLELL--ELKPGMRVL 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  142 DVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKDDPTllssgRVQLVVGDGRMGYAEEAPYDAIHVGAAAP 221
Cdd:pfam01135  79 EIGSGSGYLTACFARMVGEVGRVVSIEHIPELVEIARRNLEKLGLE-----NVIVVVGDGRQGWPEFAPYDAIHVGAAAP 153
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|...
gi 297291543  222 VVPQALIDQLKPGGRLILPVGPaGGNQMLEQYDKLQDGSVKMKPLMGVIYVPL 274
Cdd:pfam01135 154 EIPEALIDQLKEGGRLVIPVGP-NGNQVLQQFDKRNDGSVVIKDLEGVRFVPL 205
 
Name Accession Description Interval E-value
AdoMet_MTases cd02440
S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; ...
139-241 5.06e-07

S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).


Pssm-ID: 100107  Cd Length: 107  Bit Score: 46.65  E-value: 5.06e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 139 KALDVGSGSGILTACFARMVGCtgKVIGIDhikelVDDSINNVRKDDPTLLSSGRVQLVVGDGRMG-YAEEAPYDAIHVG 217
Cdd:cd02440    1 RVLDLGCGTGALALALASGPGA--RVTGVD-----ISPVALELARKAAAALLADNVEVLKGDAEELpPEADESFDVIISD 73
                         90       100       110
                 ....*....|....*....|....*....|.
gi 297291543 218 AAAPVV---PQALIDQ----LKPGGRLILPV 241
Cdd:cd02440   74 PPLHHLvedLARFLEEarrlLKPGGVLVLTL 104
pimt TIGR00080
protein-L-isoaspartate(D-aspartate) O-methyltransferase; This is an all-kingdom (but not all ...
62-281 3.69e-71

protein-L-isoaspartate(D-aspartate) O-methyltransferase; This is an all-kingdom (but not all species) full-length ortholog enzyme for repairing aging proteins. Among the prokaryotes, the gene name is pcm. Among eukaryotes, pimt. [Protein fate, Protein modification and repair]


Pssm-ID: 272896  Cd Length: 215  Bit Score: 220.85  E-value: 3.69e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543   62 KSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYA----KCNPYMDSPQSIGFQATISAPHMHAYALELLfdQLHEG 137
Cdd:TIGR00080   1 MDLESQKKALIDKLINEGYIKSKRVIDALLSVPREEFVpehfKEYAYVDTPLEIGYGQTISAPHMVAMMTELL--ELKPG 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  138 AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKddptlLSSGRVQLVVGDGRMGYAEEAPYDAIHVG 217
Cdd:TIGR00080  79 MKVLEIGTGSGYQAAVLAEIVGRDGLVVSIERIPELAEKAERRLRK-----LGLDNVIVIVGDGTQGWEPLAPYDRIYVT 153
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 297291543  218 AAAPVVPQALIDQLKPGGRLILPVGPagGNQMLEQYDKlQDGSVKMKPLMGVIYVPLTDKEKQW 281
Cdd:TIGR00080 154 AAGPKIPEALIDQLKEGGILVMPVGE--YLQVLKRAEK-RGGEIIIKDVEPVAFVPLVGGEGFQ 214
PRK13942 PRK13942
protein-L-isoaspartate O-methyltransferase; Provisional
70-278 8.10e-52

protein-L-isoaspartate O-methyltransferase; Provisional


Pssm-ID: 184409  Cd Length: 212  Bit Score: 170.97  E-value: 8.10e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  70 ELIHNLRKNGIIKTDKVFEVMLATDR----SHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLfdQLHEGAKALDVGS 145
Cdd:PRK13942   8 RVIEELIREGYIKSKKVIDALLKVPRhlfvPEYLEEYAYVDTPLEIGYGQTISAIHMVAIMCELL--DLKEGMKVLEIGT 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 146 GSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKddptlLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQ 225
Cdd:PRK13942  86 GSGYHAAVVAEIVGKSGKVVTIERIPELAEKAKKTLKK-----LGYDNVEVIVGDGTLGYEENAPYDRIYVTAAGPDIPK 160
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
gi 297291543 226 ALIDQLKPGGRLILPVGPAggNQMLEQYDKlQDGSVKMKPLMGVIYVPLTDKE 278
Cdd:PRK13942 161 PLIEQLKDGGIMVIPVGSY--SQELIRVEK-DNGKIIKKKLGEVAFVPLIGKN 210
Methyltransf_18 pfam12847
Methyltransferase domain; Protein in this family function as methyltransferases.
136-239 4.57e-11

Methyltransferase domain; Protein in this family function as methyltransferases.


Pssm-ID: 257345  Cd Length: 106  Bit Score: 58.12  E-value: 4.57e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  136 EGAKALDVGSGSGILTACFARMVgCTGKVIGIDHIKELVDDSINNVRKDdptllSSGRVQLVVGDGRMGYAEEAPYDAIH 215
Cdd:pfam12847   1 PGARVLDIGCGTGSLSIELARLF-PGAKVTGVDISPEMLELARENAKLA-----LGPRIEFVQGDAPEALDLLEGFDAVF 74
                          90       100
                  ....*....|....*....|....*....
gi 297291543  216 VGAAAPVVP-----QALIDQLKPGGRLIL 239
Cdd:pfam12847  75 IGGGGGALLellelAALASLLKPGGRLVL 103
PLN02366 PLN02366
spermidine synthase
181-235 2.02e-04

spermidine synthase


Pssm-ID: 215208  Cd Length: 308  Bit Score: 40.78  E-value: 2.02e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 297291543 181 VRKDDPtllssgRVQLVVGDGR--MGYAEEAPYDAIHVGAAAPVVP-QALIDQ---------LKPGG 235
Cdd:PLN02366 140 VGFDDP------RVNLHIGDGVefLKNAPEGTYDAIIVDSSDPVGPaQELFEKpffesvaraLRPGG 200
YrrM COG4122
Predicted O-methyltransferase YrrM [General function prediction only];
137-239 1.27e-03

Predicted O-methyltransferase YrrM [General function prediction only];


Pssm-ID: 226607  Cd Length: 219  Bit Score: 38.07  E-value: 1.27e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 137 GAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKDDptlLSSGRVQLVVGDGRMGYAEEA--PYDAI 214
Cdd:COG4122   60 PKRILEIGTAIGYSALWMALALPDDGRLTTIERDEERAEIARENLAEAG---VDDRIELLLGGDALDVLSRLLdgSFDLV 136
                         90       100
                 ....*....|....*....|....*...
gi 297291543 215 HVGAAAPVVPQAL---IDQLKPGGRLIL 239
Cdd:COG4122  137 FIDADKADYPEYLeraLPLLRPGGLIVA 164
PCMT pfam01135
Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT);
66-274 1.33e-110

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT);


Pssm-ID: 250389 [Multi-domain]  Cd Length: 205  Bit Score: 321.24  E-value: 1.33e-110
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543   66 ASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKC----NPYMDSPQSIGFQATISAPHMHAYALELLfdQLHEGAKAL 141
Cdd:pfam01135   1 NRNEALIENLKNYGVIKSDKVAEAMLAVDREEFVPEsfksYAYEDIPLSIGYGQTISAPHMHAMMLELL--ELKPGMRVL 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  142 DVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKDDPTllssgRVQLVVGDGRMGYAEEAPYDAIHVGAAAP 221
Cdd:pfam01135  79 EIGSGSGYLTACFARMVGEVGRVVSIEHIPELVEIARRNLEKLGLE-----NVIVVVGDGRQGWPEFAPYDAIHVGAAAP 153
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|...
gi 297291543  222 VVPQALIDQLKPGGRLILPVGPaGGNQMLEQYDKLQDGSVKMKPLMGVIYVPL 274
Cdd:pfam01135 154 EIPEALIDQLKEGGRLVIPVGP-NGNQVLQQFDKRNDGSVVIKDLEGVRFVPL 205
Pcm COG2518
Protein-L-isoaspartate O-methyltransferase [Posttranslational modification, protein turnover, ...
75-278 1.58e-56

Protein-L-isoaspartate O-methyltransferase [Posttranslational modification, protein turnover, chaperones]; linked to 3D-structure


Pssm-ID: 225316 [Multi-domain]  Cd Length: 209  Bit Score: 182.83  E-value: 1.58e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  75 LRKNGIIKtDKVFEVMLATDR--------SHYAkcnpYMDSPQSIGFQATISAPHMHAYALELLfdQLHEGAKALDVGSG 146
Cdd:COG2518   10 LRTEGITD-ERVLKAFLAVPRelfvpaayKHLA----YEDRALPIGCGQTISAPHMVARMLQLL--ELKPGDRVLEIGTG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 147 SGILTACFARMVGctgKVIGIDHIKELVDDSINNVRKddptlLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQA 226
Cdd:COG2518   83 SGYQAAVLARLVG---RVVSIERIEELAEQARRNLET-----LGYENVTVRHGDGSKGWPEEAPYDRIIVTAAAPEVPEA 154
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
gi 297291543 227 LIDQLKPGGRLILPVGPaGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKE 278
Cdd:COG2518  155 LLDQLKPGGRLVIPVGS-GPAQRLLRITKDGDGNFERRDLFNVRFVPLVGGD 205
methyltr_grsp TIGR04188
methyltransferase, ATP-grasp peptide maturase system; Members of this protein family are ...
134-246 1.13e-09

methyltransferase, ATP-grasp peptide maturase system; Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).


Pssm-ID: 275041 [Multi-domain]  Cd Length: 363  Bit Score: 56.98  E-value: 1.13e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  134 LHEGAKALDVGSGSGILTACFARMVGcTGKVIGIDHIKELVDDSinnvrkdDPTLLSSG-RVQLVVGDGRMGYAEEAPYD 212
Cdd:TIGR04188 105 VEDGHRVLEIGTGTGYSAALLCHRLG-DDNVTSVEVDPGLAARA-------ASALAAAGyAPTVVTGDGLLGHPPRAPYD 176
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 297291543  213 AIHVGAAAPVVPQALIDQLKPGGRLILPVG---PAGG 246
Cdd:TIGR04188 177 RIIATCAVRRVPPAWLRQTRPGGVILTTLSgwlYGGG 213
PRK08317 PRK08317
hypothetical protein; Provisional
124-239 6.03e-07

hypothetical protein; Provisional


Pssm-ID: 181382 [Multi-domain]  Cd Length: 241  Bit Score: 48.39  E-value: 6.03e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 124 AYALELLfdQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINnvRKDDptllSSGRVQLVVGDG-R 202
Cdd:PRK08317   9 ARTFELL--AVQPGDRVLDVGCGPGNDARELARRVGPEGRVVGIDRSEAMLALAKE--RAAG----LGPNVEFVRGDAdG 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 297291543 203 MGYAEEApYDAI-------HVGAaapvvPQALIDQ----LKPGGRLIL 239
Cdd:PRK08317  81 LPFPDGS-FDAVrsdrvlqHLED-----PARALAEiarvLRPGGRVVV 122
 
Name Accession Description Interval E-value
AdoMet_MTases cd02440
S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; ...
139-241 5.06e-07

S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).


Pssm-ID: 100107  Cd Length: 107  Bit Score: 46.65  E-value: 5.06e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 139 KALDVGSGSGILTACFARMVGCtgKVIGIDhikelVDDSINNVRKDDPTLLSSGRVQLVVGDGRMG-YAEEAPYDAIHVG 217
Cdd:cd02440    1 RVLDLGCGTGALALALASGPGA--RVTGVD-----ISPVALELARKAAAALLADNVEVLKGDAEELpPEADESFDVIISD 73
                         90       100       110
                 ....*....|....*....|....*....|.
gi 297291543 218 AAAPVV---PQALIDQ----LKPGGRLILPV 241
Cdd:cd02440   74 PPLHHLvedLARFLEEarrlLKPGGVLVLTL 104
pimt TIGR00080
protein-L-isoaspartate(D-aspartate) O-methyltransferase; This is an all-kingdom (but not all ...
62-281 3.69e-71

protein-L-isoaspartate(D-aspartate) O-methyltransferase; This is an all-kingdom (but not all species) full-length ortholog enzyme for repairing aging proteins. Among the prokaryotes, the gene name is pcm. Among eukaryotes, pimt. [Protein fate, Protein modification and repair]


Pssm-ID: 272896  Cd Length: 215  Bit Score: 220.85  E-value: 3.69e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543   62 KSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYA----KCNPYMDSPQSIGFQATISAPHMHAYALELLfdQLHEG 137
Cdd:TIGR00080   1 MDLESQKKALIDKLINEGYIKSKRVIDALLSVPREEFVpehfKEYAYVDTPLEIGYGQTISAPHMVAMMTELL--ELKPG 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  138 AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKddptlLSSGRVQLVVGDGRMGYAEEAPYDAIHVG 217
Cdd:TIGR00080  79 MKVLEIGTGSGYQAAVLAEIVGRDGLVVSIERIPELAEKAERRLRK-----LGLDNVIVIVGDGTQGWEPLAPYDRIYVT 153
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 297291543  218 AAAPVVPQALIDQLKPGGRLILPVGPagGNQMLEQYDKlQDGSVKMKPLMGVIYVPLTDKEKQW 281
Cdd:TIGR00080 154 AAGPKIPEALIDQLKEGGILVMPVGE--YLQVLKRAEK-RGGEIIIKDVEPVAFVPLVGGEGFQ 214
PRK13942 PRK13942
protein-L-isoaspartate O-methyltransferase; Provisional
70-278 8.10e-52

protein-L-isoaspartate O-methyltransferase; Provisional


Pssm-ID: 184409  Cd Length: 212  Bit Score: 170.97  E-value: 8.10e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  70 ELIHNLRKNGIIKTDKVFEVMLATDR----SHYAKCNPYMDSPQSIGFQATISAPHMHAYALELLfdQLHEGAKALDVGS 145
Cdd:PRK13942   8 RVIEELIREGYIKSKKVIDALLKVPRhlfvPEYLEEYAYVDTPLEIGYGQTISAIHMVAIMCELL--DLKEGMKVLEIGT 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 146 GSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKddptlLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQ 225
Cdd:PRK13942  86 GSGYHAAVVAEIVGKSGKVVTIERIPELAEKAKKTLKK-----LGYDNVEVIVGDGTLGYEENAPYDRIYVTAAGPDIPK 160
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
gi 297291543 226 ALIDQLKPGGRLILPVGPAggNQMLEQYDKlQDGSVKMKPLMGVIYVPLTDKE 278
Cdd:PRK13942 161 PLIEQLKDGGIMVIPVGSY--SQELIRVEK-DNGKIIKKKLGEVAFVPLIGKN 210
pcm PRK00312
protein-L-isoaspartate O-methyltransferase; Reviewed
71-278 9.22e-45

protein-L-isoaspartate O-methyltransferase; Reviewed


Pssm-ID: 178974  Cd Length: 212  Bit Score: 152.28  E-value: 9.22e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  71 LIHNLRKNGIiKTDKVFEVMLATDRS--------HYAkcnpYMDSPQSIGFQATISAPHMHAYALELLfdQLHEGAKALD 142
Cdd:PRK00312  12 LVLRLRAEGI-LDERVLEAIEATPRElfvpeafkHKA----YENRALPIGCGQTISQPYMVARMTELL--ELKPGDRVLE 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 143 VGSGSGILTACFARMVGctgKVIGIDHIKELVDDSINNVRKddptlLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPV 222
Cdd:PRK00312  85 IGTGSGYQAAVLAHLVR---RVFSVERIKTLQWEAKRRLKQ-----LGLHNVSVRHGDGWKGWPAYAPFDRILVTAAAPE 156
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 297291543 223 VPQALIDQLKPGGRLILPVGpaGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKE 278
Cdd:PRK00312 157 IPRALLEQLKEGGILVAPVG--GEEQQLLTRVRKRGGRFEREVLEEVRFVPLVKGE 210
PRK13944 PRK13944
protein-L-isoaspartate O-methyltransferase; Provisional
71-274 3.65e-32

protein-L-isoaspartate O-methyltransferase; Provisional


Pssm-ID: 140001  Cd Length: 205  Bit Score: 119.15  E-value: 3.65e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  71 LIHNLRKNGIIKTDKVFEVMLATDRSHYA----KCNPYMDSPQSIGFQATISAPHMHAYALELLfdQLHEGAKALDVGSG 146
Cdd:PRK13944   5 LVEELVREGIIKSERVKKAMLSVPREEFVmpeyRMMAYEDRPLPLFAGATISAPHMVAMMCELI--EPRPGMKILEVGTG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 147 SGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKddptLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQA 226
Cdd:PRK13944  83 SGYQAAVCAEAIERRGKVYTVEIVKELAIYAAQNIER----LGYWGVVEVYHGDGKRGLEKHAPFDAIIVTAAASTIPSA 158
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 297291543 227 LIDQLKPGGRLILPVGPAGGnQMLEQYDKLQDGsVKMKPLMGVIYVPL 274
Cdd:PRK13944 159 LVRQLKDGGVLVIPVEEGVG-QVLYKVVKRGEK-VEKRAITYVLFVPL 204
methyltran_FxLD TIGR04364
methyltransferase, FxLD system; Members of this family resemble occur regularly in the ...
69-241 4.54e-20

methyltransferase, FxLD system; Members of this family resemble occur regularly in the vicinity of lantibiotic biosynthesis enzymes and their probable target, the FxLD family of putative ribosomal natural product precursor (TIGR04363). Members resemble protein-L-isoaspartate O-methyltransferase (TIGR00080) and a predicted methyltranserase, TIGR04188, of another putative peptide modification system.


Pssm-ID: 275158  Cd Length: 394  Bit Score: 87.42  E-value: 4.54e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543   69 SELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNP----YM----------DSPQSIgfqATISAPHMHAYALELLfdQL 134
Cdd:TIGR04364   6 AALVDELREDGVIRSPRVEAAFRTVPRHLFAPGAPlekaYAanravvtkrdEDGRAL---SSVSAPHIQAMMLEQA--GV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  135 HEGAKALDVGSGsGILTACFARMVGCTGKVIGIDHIKELVDDSinnvRKddptLLSS---GRVQLVVGDGRMGYAEEAPY 211
Cdd:TIGR04364  81 EPGMRVLEIGSG-GYNAALLAELVGPSGEVTTVDIDEDVTDRA----RA----CLAAagyPQVTVVLADAEAGVPELAPY 151
                         170       180       190
                  ....*....|....*....|....*....|
gi 297291543  212 DAIHVGAAAPVVPQALIDQLKPGGRLILPV 241
Cdd:TIGR04364 152 DRIIVTVGAWDIPPAWLDQLAPGGRLVVPL 181
PRK13943 PRK13943
protein-L-isoaspartate O-methyltransferase; Provisional
64-241 2.49e-19

protein-L-isoaspartate O-methyltransferase; Provisional


Pssm-ID: 237568  Cd Length: 322  Bit Score: 84.51  E-value: 2.49e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  64 GGASHSELIHNLRKNGIikTDKVFEVMLATDRS-----HYAKCNPYMD----SPQSIGFQATISAPHMHAYALELLfdQL 134
Cdd:PRK13943   3 EFFMREKLFWILKKYGI--SDHIAKAFLEVPREefltkSYPLSYVYEDivlvSYDDGEEYSTSSQPSLMALFMEWV--GL 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 135 HEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKddptlLSSGRVQLVVGDGRMGYAEEAPYDAI 214
Cdd:PRK13943  79 DKGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVRR-----LGIENVIFVCGDGYYGVPEFAPYDVI 153
                        170       180
                 ....*....|....*....|....*..
gi 297291543 215 HVGAAAPVVPQALIDQLKPGGRLILPV 241
Cdd:PRK13943 154 FVTVGVDEVPETWFTQLKEGGRVIVPI 180
Methyltransf_18 pfam12847
Methyltransferase domain; Protein in this family function as methyltransferases.
136-239 4.57e-11

Methyltransferase domain; Protein in this family function as methyltransferases.


Pssm-ID: 257345  Cd Length: 106  Bit Score: 58.12  E-value: 4.57e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  136 EGAKALDVGSGSGILTACFARMVgCTGKVIGIDHIKELVDDSINNVRKDdptllSSGRVQLVVGDGRMGYAEEAPYDAIH 215
Cdd:pfam12847   1 PGARVLDIGCGTGSLSIELARLF-PGAKVTGVDISPEMLELARENAKLA-----LGPRIEFVQGDAPEALDLLEGFDAVF 74
                          90       100
                  ....*....|....*....|....*....
gi 297291543  216 VGAAAPVVP-----QALIDQLKPGGRLIL 239
Cdd:pfam12847  75 IGGGGGALLellelAALASLLKPGGRLVL 103
ubiE PRK00216
ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed
137-239 5.65e-07

ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed


Pssm-ID: 234689  Cd Length: 239  Bit Score: 48.23  E-value: 5.65e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 137 GAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDdsinNVRKDDPTLLSSGRVQLVVGDgrmgyAEEAPY----- 211
Cdd:PRK00216  52 GDKVLDLACGTGDLAIALAKAVGKTGEVVGLDFSEGMLA----VGREKLRDLGLSGNVEFVQGD-----AEALPFpdnsf 122
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 297291543 212 DAIHVGAAAPVVPQalIDQ--------LKPGGRL-IL 239
Cdd:PRK00216 123 DAVTIAFGLRNVPD--IDKalremyrvLKPGGRLvIL 157
CbiT TIGR02469
precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; This model recognizes ...
117-241 6.41e-07

precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; This model recognizes the CbiT methylase which is responsible, in part (along with CbiE), for methylating precorrin-6y (or cobalt-precorrin-6y) at both the 5 and 15 positions as well as the concomitant decarbozylation at C-12. In many organisms, this protein is fused to the CbiE subunit. The fused protein, when found in organisms catalyzing the oxidative version of the cobalamin biosynthesis pathway, is called CobL. [Biosynthesis of cofactors, prosthetic groups, and carriers, Heme, porphyrin, and cobalamin]


Pssm-ID: 274148  Cd Length: 124  Bit Score: 46.55  E-value: 6.41e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  117 ISAPHMHAYALELLfdQLHEGAKALDVGSGSGILTACFARMVGcTGKVIGIDHIKELVDDSINNVRKddptlLSSGRVQL 196
Cdd:TIGR02469   2 MTKREVRALTLAKL--RLRPGDVLWDIGAGTGSVTIEAARLVP-NGRVYAIERNPEALDLIERNLRR-----FGVSNIVI 73
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 297291543  197 VVGDgrmgyAEEAPY------DAIHVGAAA---PVVPQALIDQLKPGGRLILPV 241
Cdd:TIGR02469  74 VEGD-----APEAPEallpdpDAVFVGGSGgllQEILEAVERRLRPGGRIVLNA 122
Methyltransf_11 pfam08241
Methyltransferase domain; Members of this family are SAM dependent methyltransferases.
141-239 8.59e-07

Methyltransferase domain; Members of this family are SAM dependent methyltransferases.


Pssm-ID: 254685  Cd Length: 95  Bit Score: 45.75  E-value: 8.59e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  141 LDVGSGSGILTACFARMVGCTgkVIGIDhikeLVDDSINNVRKddptLLSSGRVQLVVGDG-RMGYAEEApYDAIHVGAA 219
Cdd:pfam08241   1 LDVGCGTGLLAEALARRGGAR--VTGVD----LSPEMLALARK----RAPRDGLEFVVGDAeDLPFPDES-FDVVVSSLV 69
                          90       100
                  ....*....|....*....|....*.
gi 297291543  220 ---APVVPQAL--IDQ-LKPGGRLIL 239
Cdd:pfam08241  70 lhhLPDPERALreIARvLKPGGKLVI 95
cbiT PRK00377
cobalt-precorrin-6Y C(15)-methyltransferase; Provisional
126-241 1.80e-05

cobalt-precorrin-6Y C(15)-methyltransferase; Provisional


Pssm-ID: 234740  Cd Length: 198  Bit Score: 43.25  E-value: 1.80e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 126 ALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKddptLLSSGRVQLVVGDGRMGY 205
Cdd:PRK00377  30 ALALSKLRLRKGDMILDIGCGTGSVTVEASLLVGETGKVYAVDKDEKAINLTRRNAEK----FGVLNNIVLIKGEAPEIL 105
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 297291543 206 AEEAP-YDAIHVGAAA---PVVPQALIDQLKPGGRLILPV 241
Cdd:PRK00377 106 FTINEkFDRIFIGGGSeklKEIISASWEIIKKGGRIVIDA 145
Methyltransf_26 pfam13659
Methyltransferase domain; This family contains methyltransferase domains.
137-239 1.90e-05

Methyltransferase domain; This family contains methyltransferase domains.


Pssm-ID: 257966  Cd Length: 117  Bit Score: 42.05  E-value: 1.90e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  137 GAKALDVGSGSGILTACFARMvGCTGKVIGID------------HIKELVDDSINNVRKD--DPTLLSSGRVQLVVGDgr 202
Cdd:pfam13659   1 GDRVLDPGAGSGAFLLAAARA-GPDARVVGVEldpeaaalarrrLALAGLAPRVRVVVGDarELLELPDGSFDLVLGN-- 77
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 297291543  203 MGYAEEAPYDAIHVGAAAPVVPQALiDQLKPGGRLIL 239
Cdd:pfam13659  78 PPYGPRAGDPKDNRDLYDRFLAAAL-RLLKPGGVLVV 113
PRK14968 PRK14968
putative methyltransferase; Provisional
128-168 3.71e-05

putative methyltransferase; Provisional


Pssm-ID: 237872  Cd Length: 188  Bit Score: 42.19  E-value: 3.71e-05
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|...
gi 297291543 128 ELLFDQLHE--GAKALDVGSGSGILTACFARMvgcTGKVIGID 168
Cdd:PRK14968  13 FLLAENAVDkkGDRVLEVGTGSGIVAIVAAKN---GKKVVGVD 52
MenG_MenH_UbiE TIGR01934
ubiquinone/menaquinone biosynthesis methyltransferases; This model represents a family of ...
133-237 9.49e-05

ubiquinone/menaquinone biosynthesis methyltransferases; This model represents a family of methyltransferases involved in the biosynthesis of menaquinone and ubiqinone. Some members such as the UbiE enzyme from E. coli are believed to act in both pathways, while others may act in only the menaquinone pathway. These methyltransferases are members of the UbiE/CoQ family of methyltransferases (pfam01209) which also contains ubiquinone methyltransferases and other methyltransferases. Members of this clade include a wide distribution of bacteria and eukaryotes, but no archaea. An outgroup for this clade is provided by the phosphatidylethanolamine methyltransferase (EC 2.1.1.17) from Rhodobacter sphaeroides. Note that a number of non-orthologous genes which are members of pfam03737 have been erroneously annotated as MenG methyltransferases. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]


Pssm-ID: 273884  Cd Length: 223  Bit Score: 41.48  E-value: 9.49e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  133 QLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELvddsINNVRKddpTLLSSGRVQLVVGDgrmgyAEEAP-- 210
Cdd:TIGR01934  36 GVFKGQKVLDVACGTGDLAIELAKSAPDRGKVTGVDFSSEM----LEVAKK---KSELPLNIEFIQAD-----AEALPfe 103
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 297291543  211 ---YDAIHVGAA---APVVPQAL---IDQLKPGGRL 237
Cdd:TIGR01934 104 dnsFDAVTIAFGlrnVTDIQKALremYRVLKPGGRL 139
MTS pfam05175
Methyltransferase small domain; This domain is found in ribosomal RNA small subunit ...
131-239 1.23e-04

Methyltransferase small domain; This domain is found in ribosomal RNA small subunit methyltransferase C as well as other methyltransferases.


Pssm-ID: 253060  Cd Length: 170  Bit Score: 40.64  E-value: 1.23e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  131 FDQLHEGaKALDVGSGSGILTACFARMVGctgkvigiDHIKELVDDSINNVRKDDPTLLSSG--RVQLVVGDGRMGyAEE 208
Cdd:pfam05175  27 LPKPLGG-KVLDLGCGYGVLGAALAKRSP--------DLEVTMVDINARALESAKANLEANGleNGEVVWSDLYSA-VEP 96
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 297291543  209 APYDAI------HVG-AAAPVVPQALIDQ----LKPGGRLIL 239
Cdd:pfam05175  97 GKFDLIisnppfHAGlATDYDIAQRFIADaarhLKPGGELWI 138
Ubie_methyltran pfam01209
ubiE/COQ5 methyltransferase family;
136-238 1.41e-04

ubiE/COQ5 methyltransferase family;


Pssm-ID: 110227  Cd Length: 233  Bit Score: 40.89  E-value: 1.41e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  136 EGAKALDVGSGSGILTACFARMVGCTGKVIGIDhikelvddsINnvrkddPTLLSSGR----------VQLVVGDGRMGY 205
Cdd:pfam01209  47 RGNKFLDVAGGTGDWTFGLSDSAGSSGKVVGLD---------IN------ENMLKEGEkkakeegkynIEFLQGNAEELP 111
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 297291543  206 AEEAPYDAIHVGAA---APVVPQALIDQ---LKPGGRLI 238
Cdd:pfam01209 112 FEDDSFDIVTISFGlrnFPDYLKVLKEAfrvLKPGGRVV 150
PLN02366 PLN02366
spermidine synthase
181-235 2.02e-04

spermidine synthase


Pssm-ID: 215208  Cd Length: 308  Bit Score: 40.78  E-value: 2.02e-04
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 297291543 181 VRKDDPtllssgRVQLVVGDGR--MGYAEEAPYDAIHVGAAAPVVP-QALIDQ---------LKPGG 235
Cdd:PLN02366 140 VGFDDP------RVNLHIGDGVefLKNAPEGTYDAIIVDSSDPVGPaQELFEKpffesvaraLRPGG 200
MenG_heptapren TIGR02752
demethylmenaquinone methyltransferase; MenG is a generic term for a methyltransferase that ...
136-238 3.09e-04

demethylmenaquinone methyltransferase; MenG is a generic term for a methyltransferase that catalyzes the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species. Members of this MenG protein family are 2-heptaprenyl-1,4-naphthoquinone methyltransferase, and are found together in operons with the two subunits of the heptaprenyl diphosphate synthase in Bacillus subtilis and related species. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]


Pssm-ID: 131799  Cd Length: 231  Bit Score: 39.79  E-value: 3.09e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  136 EGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVddSINNVRKDDPTLlssGRVQLVVGDgrmgyAEEAPY---- 211
Cdd:TIGR02752  45 AGTSALDVCCGTADWSIALAEAVGPEGHVIGLDFSENML--SVGRQKVKDAGL---HNVELVHGN-----AMELPFddns 114
                          90       100       110
                  ....*....|....*....|....*....|....
gi 297291543  212 -DAIHVGAAAPVVP------QALIDQLKPGGRLI 238
Cdd:TIGR02752 115 fDYVTIGFGLRNVPdymqvlREMYRVVKPGGKVV 148
YrrM COG4122
Predicted O-methyltransferase YrrM [General function prediction only];
137-239 1.27e-03

Predicted O-methyltransferase YrrM [General function prediction only];


Pssm-ID: 226607  Cd Length: 219  Bit Score: 38.07  E-value: 1.27e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 137 GAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKDDptlLSSGRVQLVVGDGRMGYAEEA--PYDAI 214
Cdd:COG4122   60 PKRILEIGTAIGYSALWMALALPDDGRLTTIERDEERAEIARENLAEAG---VDDRIELLLGGDALDVLSRLLdgSFDLV 136
                         90       100
                 ....*....|....*....|....*...
gi 297291543 215 HVGAAAPVVPQAL---IDQLKPGGRLIL 239
Cdd:COG4122  137 FIDADKADYPEYLeraLPLLRPGGLIVA 164
Methyltransf_23 pfam13489
Methyltransferase domain; This family appears to be a methyltransferase domain.
119-239 1.30e-03

Methyltransferase domain; This family appears to be a methyltransferase domain.


Pssm-ID: 257813  Cd Length: 157  Bit Score: 37.48  E-value: 1.30e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  119 APHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARmVGCtgKVIGIdhikelvddsinnvrkdDPTLLSSGRVQLVV 198
Cdd:pfam13489   5 RRRFLARLLARLLPRLKPGGRVLDIGCGTGILLRLLRE-RGF--DVTGV-----------------DPSPEAVENVIFKV 64
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*...
gi 297291543  199 GDGRMGYAEEAPYDAI-------HVGAAAPVVpQALIDQLKPGGRLIL 239
Cdd:pfam13489  65 FDAPDAAVLAGKYDLItafevleHLPDPPALL-RQLAELLKPGGVLLV 111
PRK08287 PRK08287
cobalt-precorrin-6Y C(15)-methyltransferase; Validated
124-239 5.40e-03

cobalt-precorrin-6Y C(15)-methyltransferase; Validated


Pssm-ID: 181354  Cd Length: 187  Bit Score: 35.75  E-value: 5.40e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 124 AYALELLfdQLHEGAKALDVGSGSG---ILTAC-FARMvgctgKVIGIDHIKELVDDSINNVRKddptlLSSGRVQLVVG 199
Cdd:PRK08287  21 ALALSKL--ELHRAKHLIDVGAGTGsvsIEAALqFPSL-----QVTAIERNPDALRLIKENRQR-----FGCGNIDIIPG 88
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 297291543 200 DGRMGYAEEApyDAIHVGAAAPVVpQALID----QLKPGGRLIL 239
Cdd:PRK08287  89 EAPIELPGKA--DAIFIGGSGGNL-TAIIDwslaHLHPGGRLVL 129
PCMT pfam01135
Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT);
66-274 1.33e-110

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT);


Pssm-ID: 250389 [Multi-domain]  Cd Length: 205  Bit Score: 321.24  E-value: 1.33e-110
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543   66 ASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKC----NPYMDSPQSIGFQATISAPHMHAYALELLfdQLHEGAKAL 141
Cdd:pfam01135   1 NRNEALIENLKNYGVIKSDKVAEAMLAVDREEFVPEsfksYAYEDIPLSIGYGQTISAPHMHAMMLELL--ELKPGMRVL 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  142 DVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKDDPTllssgRVQLVVGDGRMGYAEEAPYDAIHVGAAAP 221
Cdd:pfam01135  79 EIGSGSGYLTACFARMVGEVGRVVSIEHIPELVEIARRNLEKLGLE-----NVIVVVGDGRQGWPEFAPYDAIHVGAAAP 153
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|...
gi 297291543  222 VVPQALIDQLKPGGRLILPVGPaGGNQMLEQYDKLQDGSVKMKPLMGVIYVPL 274
Cdd:pfam01135 154 EIPEALIDQLKEGGRLVIPVGP-NGNQVLQQFDKRNDGSVVIKDLEGVRFVPL 205
Pcm COG2518
Protein-L-isoaspartate O-methyltransferase [Posttranslational modification, protein turnover, ...
75-278 1.58e-56

Protein-L-isoaspartate O-methyltransferase [Posttranslational modification, protein turnover, chaperones]; linked to 3D-structure


Pssm-ID: 225316 [Multi-domain]  Cd Length: 209  Bit Score: 182.83  E-value: 1.58e-56
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  75 LRKNGIIKtDKVFEVMLATDR--------SHYAkcnpYMDSPQSIGFQATISAPHMHAYALELLfdQLHEGAKALDVGSG 146
Cdd:COG2518   10 LRTEGITD-ERVLKAFLAVPRelfvpaayKHLA----YEDRALPIGCGQTISAPHMVARMLQLL--ELKPGDRVLEIGTG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 147 SGILTACFARMVGctgKVIGIDHIKELVDDSINNVRKddptlLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQA 226
Cdd:COG2518   83 SGYQAAVLARLVG---RVVSIERIEELAEQARRNLET-----LGYENVTVRHGDGSKGWPEEAPYDRIIVTAAAPEVPEA 154
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
gi 297291543 227 LIDQLKPGGRLILPVGPaGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKE 278
Cdd:COG2518  155 LLDQLKPGGRLVIPVGS-GPAQRLLRITKDGDGNFERRDLFNVRFVPLVGGD 205
methyltr_grsp TIGR04188
methyltransferase, ATP-grasp peptide maturase system; Members of this protein family are ...
134-246 1.13e-09

methyltransferase, ATP-grasp peptide maturase system; Members of this protein family are predicted SAM-dependent methyltransferases that regularly occur in the context of a putative peptide modification ATP-grasp enzyme (TIGR04187, related to enzymes of microviridin maturation) and a putative ribosomal peptide modification target (TIGR04186).


Pssm-ID: 275041 [Multi-domain]  Cd Length: 363  Bit Score: 56.98  E-value: 1.13e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  134 LHEGAKALDVGSGSGILTACFARMVGcTGKVIGIDHIKELVDDSinnvrkdDPTLLSSG-RVQLVVGDGRMGYAEEAPYD 212
Cdd:TIGR04188 105 VEDGHRVLEIGTGTGYSAALLCHRLG-DDNVTSVEVDPGLAARA-------ASALAAAGyAPTVVTGDGLLGHPPRAPYD 176
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 297291543  213 AIHVGAAAPVVPQALIDQLKPGGRLILPVG---PAGG 246
Cdd:TIGR04188 177 RIIATCAVRRVPPAWLRQTRPGGVILTTLSgwlYGGG 213
Methyltransf_31 pfam13847
Methyltransferase domain; This family appears to be have methyltransferase activity.
134-263 3.29e-09

Methyltransferase domain; This family appears to be have methyltransferase activity.


Pssm-ID: 258120 [Multi-domain]  Cd Length: 151  Bit Score: 53.58  E-value: 3.29e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  134 LHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKDDPTllssgRVQLVVGDgrmgyAEEAP--- 210
Cdd:pfam13847   1 LKSGIKVLDLGCGTGYLSFILAEKLGPGAKVVGIDISEEAIEKAKENAKKLGYE-----NVEFIQGD-----IEELPqle 70
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 297291543  211 -----YD------AIHVGAAAPVVPQALIDQLKPGGRLIL--PVGPAGGNQMLEQYDKLQDGSVKM 263
Cdd:pfam13847  71 lednsFDvvisneVLNHLPDPDKVLEEIIRVLKPGGVLIVsdPVLLSELPALLEELEELYAGVLEG 136
CobL COG2242
Precorrin-6B methylase 2 [Coenzyme transport and metabolism];
117-239 6.01e-09

Precorrin-6B methylase 2 [Coenzyme transport and metabolism];


Pssm-ID: 225151 [Multi-domain]  Cd Length: 187  Bit Score: 53.40  E-value: 6.01e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 117 ISAPHMHAYALELLfdQLHEGAKALDVGSGSGILTaCFARMVGCTGKVIGIDHIKELVDDSINNVRKddptlLSSGRVQL 196
Cdd:COG2242   17 MTKEEIRALTLSKL--RPRPGDRLWDIGAGTGSIT-IEWALAGPSGRVIAIERDEEALELIERNAAR-----FGVDNLEV 88
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 297291543 197 VVGDGRMGYAEEAPYDAIHVGAAAPV--VPQALIDQLKPGGRLIL 239
Cdd:COG2242   89 VEGDAPEALPDLPSPDAIFIGGGGNIeeILEAAWERLKPGGRLVA 133
PrmA COG2264
Ribosomal protein L11 methylase PrmA [Translation, ribosomal structure and biogenesis];
124-239 1.40e-08

Ribosomal protein L11 methylase PrmA [Translation, ribosomal structure and biogenesis];


Pssm-ID: 225173 [Multi-domain]  Cd Length: 300  Bit Score: 53.46  E-value: 1.40e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 124 AYALELLFDQLHEGAKALDVGSGSGILtACFARMVGCtGKVIGIDhIKEL-VDDSINNVRKDDPTLlssgRVQLVVGDGR 202
Cdd:COG2264  150 SLCLEALEKLLKKGKTVLDVGCGSGIL-AIAAAKLGA-KKVVGVD-IDPQaVEAARENARLNGVEL----LVQAKGFLLL 222
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 297291543 203 MGyAEEAPYDAIhVgA---AAPVV---PQALIdQLKPGGRLIL 239
Cdd:COG2264  223 EV-PENGPFDVI-V-AnilAEVLVelaPDIKR-LLKPGGRLIL 261
Gcd14 COG2519
tRNA A58 N-methylase Trm61 [Translation, ribosomal structure and biogenesis]; linked to ...
134-238 1.72e-08

tRNA A58 N-methylase Trm61 [Translation, ribosomal structure and biogenesis]; linked to 3D-structure


Pssm-ID: 225317 [Multi-domain]  Cd Length: 256  Bit Score: 53.07  E-value: 1.72e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 134 LHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINNVRKddptLLSSGRVQLVVGDGRmGYAEEAPYDA 213
Cdd:COG2519   92 ISPGSRVLEAGTGSGALTAYLARAVGPEGHVTTYEIREDFAKTARENLSE----FGLGDRVTLKLGDVR-EGIDEEDVDA 166
                         90       100
                 ....*....|....*....|....*.
gi 297291543 214 IHVGAAAPV-VPQALIDQLKPGGRLI 238
Cdd:COG2519  167 VFLDLPDPWnVLEHVSDALKPGGVVV 192
PRK08317 PRK08317
hypothetical protein; Provisional
124-239 6.03e-07

hypothetical protein; Provisional


Pssm-ID: 181382 [Multi-domain]  Cd Length: 241  Bit Score: 48.39  E-value: 6.03e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 124 AYALELLfdQLHEGAKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSINnvRKDDptllSSGRVQLVVGDG-R 202
Cdd:PRK08317   9 ARTFELL--AVQPGDRVLDVGCGPGNDARELARRVGPEGRVVGIDRSEAMLALAKE--RAAG----LGPNVEFVRGDAdG 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 297291543 203 MGYAEEApYDAI-------HVGAaapvvPQALIDQ----LKPGGRLIL 239
Cdd:PRK08317  81 LPFPDGS-FDAVrsdrvlqHLED-----PARALAEiarvLRPGGRVVV 122
UbiE COG2226
Ubiquinone/menaquinone biosynthesis C-methylase UbiE [Coenzyme transport and metabolism];
133-238 6.80e-07

Ubiquinone/menaquinone biosynthesis C-methylase UbiE [Coenzyme transport and metabolism];


Pssm-ID: 225136 [Multi-domain]  Cd Length: 238  Bit Score: 48.03  E-value: 6.80e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 133 QLHEGAKALDVGSGSGILTACFARMVGcTGKVIGIDHikelVDDSINNVRKDDPTLLSSGrVQLVVGDgrmgyAEEAPY- 211
Cdd:COG2226   48 GIKPGDKVLDVACGTGDMALLLAKSVG-TGEVVGLDI----SESMLEVAREKLKKKGVQN-VEFVVGD-----AENLPFp 116
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 297291543 212 ----DAIHVGAAAPVVPQalIDQ--------LKPGGRLI 238
Cdd:COG2226  117 dnsfDAVTISFGLRNVTD--IDKalkemyrvLKPGGRLL 153
arsM PRK11873
arsenite S-adenosylmethyltransferase; Reviewed
131-183 2.63e-06

arsenite S-adenosylmethyltransferase; Reviewed


Pssm-ID: 237007 [Multi-domain]  Cd Length: 272  Bit Score: 46.48  E-value: 2.63e-06
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 297291543 131 FDQLHEGAKALDVGSGSGIltACF--ARMVGCTGKVIGIDHIKELVDDSINNVRK 183
Cdd:PRK11873  72 LAELKPGETVLDLGSGGGF--DCFlaARRVGPTGKVIGVDMTPEMLAKARANARK 124
prmA PRK00517
ribosomal protein L11 methyltransferase; Reviewed
127-239 6.06e-06

ribosomal protein L11 methyltransferase; Reviewed


Pssm-ID: 234786 [Multi-domain]  Cd Length: 250  Bit Score: 45.14  E-value: 6.06e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 127 LELLFDQLHEGAKALDVGSGSGILtACFARMVGCTgKVIGIDhIKEL-VDDSINNVRkddptlLSSGRVQLVVGDGrmgy 205
Cdd:PRK00517 110 LEALEKLVLPGKTVLDVGCGSGIL-AIAAAKLGAK-KVLAVD-IDPQaVEAARENAE------LNGVELNVYLPQG---- 176
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
gi 297291543 206 aeEAPYDAIhVgA---AAPVVpqALIDQ----LKPGGRLIL 239
Cdd:PRK00517 177 --DLKADVI-V-AnilANPLL--ELAPDlarlLKPGGRLIL 211
UbiG TIGR01983
ubiquinone biosynthesis O-methyltransferase; This model represents an O-methyltransferase ...
136-284 6.79e-06

ubiquinone biosynthesis O-methyltransferase; This model represents an O-methyltransferase believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and fungi (COQ3). A separate methylase (MenG/UbiE) catalyzes the single C-methylation step. The most commonly used names for genes in this family do not indicate whether this gene is an O-methyl, or C-methyl transferase. [Biosynthesis of cofactors, prosthetic groups, and carriers, Menaquinone and ubiquinone]


Pssm-ID: 273910 [Multi-domain]  Cd Length: 224  Bit Score: 44.98  E-value: 6.79e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  136 EGAKALDVGSGSGILTACFARMvgcTGKVIGIDHIKELVDDSINNVRKDDptLLSSGRVQLVvgdGRMGYAEEAPYDAI- 214
Cdd:TIGR01983  46 DGLRVLDVGCGGGLLSEPLARL---GANVTGIDASEENIEVAKLHAKKDP--LQIDYRCTTV---EDLAEKKAGSFDVVt 117
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  215 ------HVgAAAPVVPQALIDQLKPGGRL------------------------ILPVG---------PAggnqmlEQYDK 255
Cdd:TIGR01983 118 cmevleHV-PDPQAFIRACAQLLKPGGILffstinrtpksyllaivgaeyilrIVPKGthdwekfikPS------ELLSW 190
                         170       180
                  ....*....|....*....|....*....
gi 297291543  256 LQDGSVKMKPLMGVIYVPLTDkEKQWSRD 284
Cdd:TIGR01983 191 LESAGLRVKDIKGLVYNPIKN-TWKLSKD 218
BchM-ChlM TIGR02021
magnesium protoporphyrin O-methyltransferase; This model represents the ...
112-214 1.31e-05

magnesium protoporphyrin O-methyltransferase; This model represents the S-adenosylmethionine-dependent O-methyltransferase responsible for methylation of magnesium protoporphyrin IX. This step is essentiasl for the biosynthesis of both chlorophyll and bacteriochlorophyll. This model encompasses two closely related clades, from cyanobacteria (and plants) where it is called ChlM and other photosynthetic bacteria where it is known as BchM. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]


Pssm-ID: 273930 [Multi-domain]  Cd Length: 219  Bit Score: 44.02  E-value: 1.31e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  112 GFQATISAPH--MHAYALELLFDQLHEGAKALDVGSGSGILTACFARMvgcTGKVIGIDHIKELVddsiNNVRKDDPTLL 189
Cdd:TIGR02021  29 RVRQTVREGRaaMRRKLLDWLPKDPLKGKRVLDAGCGTGLLSIELAKR---GAIVKAVDISEQMV----QMARNRAQGRD 101
                          90       100
                  ....*....|....*....|....*
gi 297291543  190 SSGRVQLVVGDGRmgyAEEAPYDAI 214
Cdd:TIGR02021 102 VAGNVEFEVNDLL---SLCGEFDIV 123
SmtA COG0500
SAM-dependent methyltransferase [Secondary metabolites biosynthesis, transport and catabolism, ...
102-239 3.22e-05

SAM-dependent methyltransferase [Secondary metabolites biosynthesis, transport and catabolism, General function prediction only];


Pssm-ID: 223574 [Multi-domain]  Cd Length: 257  Bit Score: 43.35  E-value: 3.22e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 102 NPYMDSPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTAcFARMVGCTGKVIGIDHIKELVDDSINNV 181
Cdd:COG0500   14 ELYDRLAELLDAFLLLAEELLDLLLVLRLLRLLPGGLGVLDIGCGTGRLAL-LARLGGRGAYVVGVDLSPEMLALARARA 92
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 297291543 182 RKDDptllsSGRVQLVVGD---GRMGYAEEAPYDAIHVGAAAPVVPQA-----LIDQLKPGGRLIL 239
Cdd:COG0500   93 EGAG-----LGLVDFVVADalgGVLPFEDSASFDLVISLLVLHLLPPAkalreLLRVLKPGGRLVL 153
prmA TIGR00406
ribosomal protein L11 methyltransferase; Ribosomal protein L11 methyltransferase is an ...
127-239 5.73e-04

ribosomal protein L11 methyltransferase; Ribosomal protein L11 methyltransferase is an S-adenosyl-L-methionine-dependent methyltransferase required for the modification of ribosomal protein L11. This protein is found in bacteria and (with a probable transit peptide) in Arabidopsis. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 273061 [Multi-domain]  Cd Length: 288  Bit Score: 39.43  E-value: 5.73e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  127 LELLFDQLHEGAKALDVGSGSGILtACFARMVGCTgKVIGIDHIKELVDDSINNVRKDDPTLlssgRVQLVVGDGRMGya 206
Cdd:TIGR00406 150 LEWLEDLDLKDKNVIDVGCGSGIL-SIAALKLGAA-KVVGIDIDPLAVESARKNAELNQVSD----RLQVKLIYLEQP-- 221
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 297291543  207 EEAPYDAIHVGAAAPVV----PQAlIDQLKPGGRLIL 239
Cdd:TIGR00406 222 IEGKADVIVANILAEVIkelyPQF-SRLVKPGGWLIL 257
PRK05134 PRK05134
bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol ...
136-239 3.98e-03

bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional


Pssm-ID: 235350 [Multi-domain]  Cd Length: 233  Bit Score: 36.67  E-value: 3.98e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543 136 EGAKALDVGSGSGILTACFARMvGctGKVIGIDhikeLVDDSINNVRKDdptLLSSGrVQLvvgDGRMGYAEE------A 209
Cdd:PRK05134  48 FGKRVLDVGCGGGILSESMARL-G--ADVTGID----ASEENIEVARLH---ALESG-LKI---DYRQTTAEElaaehpG 113
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 297291543 210 PYDAI-------HVGAAAPVVpQALIDQLKPGGRLIL 239
Cdd:PRK05134 114 QFDVVtcmemleHVPDPASFV-RACAKLVKPGGLVFF 149
PrmA pfam06325
Ribosomal protein L11 methyltransferase (PrmA); This family consists of several Ribosomal ...
127-239 4.41e-03

Ribosomal protein L11 methyltransferase (PrmA); This family consists of several Ribosomal protein L11 methyltransferase (EC:2.1.1.-) sequences.


Pssm-ID: 253677 [Multi-domain]  Cd Length: 294  Bit Score: 36.46  E-value: 4.41e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297291543  127 LELLFDQLHEGAKALDVGSGSGILtACFARMVGcTGKVIGIDhIKEL-VDDSINNVRKDDPTLlssgRVQLVVGDGrmgy 205
Cdd:pfam06325 151 LEALESLVKPGETVLDVGCGSGIL-AIAALKLG-AKKVVGVD-IDPVaVRAAKENAELNGVEA----QLEVYLPGD---- 219
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 297291543  206 AEEAPYDAIhVG--AAAPVVpqALIDQ----LKPGGRLIL 239
Cdd:pfam06325 220 LPEGKADVV-VAniLADPLI--ELAPDiyalVKPGGYLIL 256
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH