NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|297281474|ref|XP_001092727.2|]
View 

PREDICTED: nucleoside diphosphate kinase 7 [Macaca mulatta]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
NDPk7A cd04415
Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate ...
92-222 1.02e-86

Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B. The function of the DM10 domain, which also occurs in multiple copies in other proteins, is unknown. NDPk7 is predominantly expressed in testes, although appreciable amount are also found in liver, heart, brain, ovary, small intestine and spleen. The nm23-H7 gene is located in or near the hereditary prostrate cancer susceptibility locus. Nm23-H7 may be involved in the development of colon and gastric carcinoma, the latter possibly in a type-specific manner.


:

Pssm-ID: 239878 [Multi-domain]  Cd Length: 131  Bit Score: 259.68  E-value: 1.02e-86
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAICE 171
Cdd:cd04415    1 EKTLALIKPDAYSKIGKIIQIIEDAGFTITKAKMTKLSRKEAQDFYAEHQSKPFYNELVQFMTSGPIVAMELVGDDAISE 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 297281474 172 WKRLLGPANSGVARTDASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:cd04415   81 WRKLLGPTNSSVARSDAPNSIRALFGTDGTRNAAHGSDSVASAARELEFFF 131
NDPk7B cd04412
Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate ...
238-330 6.48e-52

Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B. The function of the DM10 domain, which also occurs in multiple copies in other proteins, is unknown. NDPk7 is predominantly expressed in testes, although appreciable amount are also found in liver, heart, brain, ovary, small intestine and spleen. The nm23-H7 gene is located in or near the hereditary prostrate cancer susceptibility locus. Nm23-H7 may be involved in the development of colon and gastric carcinoma, the latter possibly in a type-specific manner.


:

Pssm-ID: 239875  Cd Length: 134  Bit Score: 170.12  E-value: 6.48e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 238 NCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNA 317
Cdd:cd04412    1 NCTVCIIKPHAVSHGLLGEILQQILDEGFEITALQMFNLTRANAEEFLEVYKGVVPELPAMVDELTSGPCIALEIAGENA 80
                         90
                 ....*....|...
gi 297281474 318 TKTFREFCGPVDP 330
Cdd:cd04412   81 VKTFREFCGPFDP 93
DM10 smart00676
Domains in hypothetical proteins in Drosophila, C. elegans and mammals. Occurs singly in some ...
3-91 7.97e-32

Domains in hypothetical proteins in Drosophila, C. elegans and mammals. Occurs singly in some nucleoside diphosphate kinases;


:

Pssm-ID: 128921  Cd Length: 104  Bit Score: 115.87  E-value: 7.97e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474     3 HSERFVFIAEWYDPNA--SLLRRYELLFYPGDGSVEMH--DVKN----HRTFLKRTKY--------DSLHLEDLFIGNKV 66
Cdd:smart00676   1 DKKVLRFDAYWEDPVAmfYLIRRFKIYYYLEDDTIEVFepDVRNsgilQGTFLRRQRVpkpppddpEYYHASDLNVGTTI 80
                           90       100
                   ....*....|....*....|....*
gi 297281474    67 NVFSRQLVLIDYgDQYTARQLGSRK 91
Cdd:smart00676  81 NVFGRQFRIYDC-DEFTRNYLESKG 104
NDK smart00562
Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to ...
92-225 1.34e-61

Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates; These enzymes play important roles in bacterial growth, signal transduction and pathogenicity.


:

Pssm-ID: 197791 [Multi-domain]  Cd Length: 135  Bit Score: 195.46  E-value: 1.34e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474    92 EKTLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAI 169
Cdd:smart00562   1 ERTLAIIKPDAVQRglIGEIISRFERKGFKIVAMKMLQLTEEQAEEFYAEHEGKPFFNDLVEFMTSGPVVAMVLEGEDAV 80
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 297281474   170 CEWKRLLGPANsgvARTDASGSIRALFGTDGIRNAAHGPDSFASAAREMELFFPSS 225
Cdd:smart00562  81 KTWRTLMGPTD---PREAAPGTIRGDFGLDIGRNAVHGSDSPESAEREIALFFPES 133
 
Name Accession Description Interval E-value
NDPk7A cd04415
Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate ...
92-222 1.02e-86

Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B. The function of the DM10 domain, which also occurs in multiple copies in other proteins, is unknown. NDPk7 is predominantly expressed in testes, although appreciable amount are also found in liver, heart, brain, ovary, small intestine and spleen. The nm23-H7 gene is located in or near the hereditary prostrate cancer susceptibility locus. Nm23-H7 may be involved in the development of colon and gastric carcinoma, the latter possibly in a type-specific manner.


Pssm-ID: 239878 [Multi-domain]  Cd Length: 131  Bit Score: 259.68  E-value: 1.02e-86
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAICE 171
Cdd:cd04415    1 EKTLALIKPDAYSKIGKIIQIIEDAGFTITKAKMTKLSRKEAQDFYAEHQSKPFYNELVQFMTSGPIVAMELVGDDAISE 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 297281474 172 WKRLLGPANSGVARTDASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:cd04415   81 WRKLLGPTNSSVARSDAPNSIRALFGTDGTRNAAHGSDSVASAARELEFFF 131
NDPk7B cd04412
Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate ...
238-330 6.48e-52

Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B. The function of the DM10 domain, which also occurs in multiple copies in other proteins, is unknown. NDPk7 is predominantly expressed in testes, although appreciable amount are also found in liver, heart, brain, ovary, small intestine and spleen. The nm23-H7 gene is located in or near the hereditary prostrate cancer susceptibility locus. Nm23-H7 may be involved in the development of colon and gastric carcinoma, the latter possibly in a type-specific manner.


Pssm-ID: 239875  Cd Length: 134  Bit Score: 170.12  E-value: 6.48e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 238 NCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNA 317
Cdd:cd04412    1 NCTVCIIKPHAVSHGLLGEILQQILDEGFEITALQMFNLTRANAEEFLEVYKGVVPELPAMVDELTSGPCIALEIAGENA 80
                         90
                 ....*....|...
gi 297281474 318 TKTFREFCGPVDP 330
Cdd:cd04412   81 VKTFREFCGPFDP 93
Ndk COG0105
Nucleoside diphosphate kinase [Nucleotide transport and metabolism]; linked to 3D-structure
92-225 3.81e-44

Nucleoside diphosphate kinase [Nucleotide transport and metabolism]; linked to 3D-structure


Pssm-ID: 223183  Cd Length: 135  Bit Score: 150.01  E-value: 3.81e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISKA--GEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAI 169
Cdd:COG0105    3 ERTLSIIKPDAVKRGliGEIISRFEKKGLKIVALKMVQLSRELAENHYAEHKGKPFFGELVEFITSGPVVAMVLEGENAI 82
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 297281474 170 CEWKRLLGPANSGVArtdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFFPSS 225
Cdd:COG0105   83 SVVRKLMGATNPANA---APGTIRGDFALSVGENVVHGSDSPESAEREIALFFSKS 135
ndk PRK00668
mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated
92-225 1.22e-43

mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated


Pssm-ID: 179085  Cd Length: 134  Bit Score: 148.33  E-value: 1.22e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAI 169
Cdd:PRK00668   2 ERTFSIIKPDAVQRglIGEIISRFEKKGLKIVALKMMQLSRELAEGHYAEHKEKPFFGELVEFMTSGPVVVMVLEGENAI 81
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 297281474 170 CEWKRLLGPANSGVArtdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFFPSS 225
Cdd:PRK00668  82 AKVRELMGATNPAEA---APGTIRGDFALSIGENVVHGSDSPESAAREIALFFSEE 134
PLN02931 PLN02931
nucleoside diphosphate kinase family protein
89-222 1.86e-36

nucleoside diphosphate kinase family protein


Pssm-ID: 215503  Cd Length: 177  Bit Score: 131.10  E-value: 1.86e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  89 SRKEKTLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRD 166
Cdd:PLN02931  27 SEEERTLAMIKPDGLSGnyTERIKEVILESGFSIVKEMTTQLDEDRASLFYAEHSSRSFFPSLVKYMTSGPVLVMVLEKE 106
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 297281474 167 DAICEWKRLLGPANSGVARTDASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:PLN02931 107 NAVSDWRTLIGPTDARKAKISHPNSIRAMCGLDSEKNCVHGSDSPESAEREISFFF 162
DM10 smart00676
Domains in hypothetical proteins in Drosophila, C. elegans and mammals. Occurs singly in some ...
3-91 7.97e-32

Domains in hypothetical proteins in Drosophila, C. elegans and mammals. Occurs singly in some nucleoside diphosphate kinases;


Pssm-ID: 128921  Cd Length: 104  Bit Score: 115.87  E-value: 7.97e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474     3 HSERFVFIAEWYDPNA--SLLRRYELLFYPGDGSVEMH--DVKN----HRTFLKRTKY--------DSLHLEDLFIGNKV 66
Cdd:smart00676   1 DKKVLRFDAYWEDPVAmfYLIRRFKIYYYLEDDTIEVFepDVRNsgilQGTFLRRQRVpkpppddpEYYHASDLNVGTTI 80
                           90       100
                   ....*....|....*....|....*
gi 297281474    67 NVFSRQLVLIDYgDQYTARQLGSRK 91
Cdd:smart00676  81 NVFGRQFRIYDC-DEFTRNYLESKG 104
PTZ00093 PTZ00093
nucleoside diphosphate kinase, cytosolic; Provisional
91-222 1.74e-28

nucleoside diphosphate kinase, cytosolic; Provisional


Pssm-ID: 173387  Cd Length: 149  Bit Score: 108.27  E-value: 1.74e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  91 KEKTLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDA 168
Cdd:PTZ00093   2 SERTFIMVKPDGVQRglVGEIIKRFEKKGYKLVALKMLQPTPEIAEEHYKEHKGKPFFPGLVKYISSGPVVCMVWEGKNV 81
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 297281474 169 ICEWKRLLGPANSGVArtdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:PTZ00093  82 VKQGRKLLGATNPLES---APGTIRGDFCVDVGRNVIHGSDSVESAKREIALWF 132
Ndk COG0105
Nucleoside diphosphate kinase [Nucleotide transport and metabolism]; linked to 3D-structure
240-330 2.57e-17

Nucleoside diphosphate kinase [Nucleotide transport and metabolism]; linked to 3D-structure


Pssm-ID: 223183  Cd Length: 135  Bit Score: 76.44  E-value: 2.57e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 240 TCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTeYHDMVTEMYSGPCVAMEIQQNNATK 319
Cdd:COG0105    5 TLSIIKPDAVKRGLIGEIISRFEKKGLKIVALKMVQLSRELAENHYAEHKGKPF-FGELVEFITSGPVVAMVLEGENAIS 83
                         90
                 ....*....|.
gi 297281474 320 TFREFCGPVDP 330
Cdd:COG0105   84 VVRKLMGATNP 94
ndk PRK00668
mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated
243-330 4.88e-16

mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated


Pssm-ID: 179085  Cd Length: 134  Bit Score: 73.22  E-value: 4.88e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 243 IVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKgvvtE---YHDMVTEMYSGPCVAMEIQQNNATK 319
Cdd:PRK00668   7 IIKPDAVQRGLIGEIISRFEKKGLKIVALKMMQLSRELAEGHYAEHK----EkpfFGELVEFMTSGPVVVMVLEGENAIA 82
                         90
                 ....*....|.
gi 297281474 320 TFREFCGPVDP 330
Cdd:PRK00668  83 KVRELMGATNP 93
PLN02931 PLN02931
nucleoside diphosphate kinase family protein
221-338 2.13e-07

nucleoside diphosphate kinase family protein


Pssm-ID: 215503  Cd Length: 177  Bit Score: 49.05  E-value: 2.13e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 221 FFPSSGGCGPANTAKftncTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVvTEYHDMVT 300
Cdd:PLN02931  17 FPIRCSSSGASEEER----TLAMIKPDGLSGNYTERIKEVILESGFSIVKEMTTQLDEDRASLFYAEHSSR-SFFPSLVK 91
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 297281474 301 EMYSGPCVAMEIQQNNATKTFREFCGPVDPTpKSPISH 338
Cdd:PLN02931  92 YMTSGPVLVMVLEKENAVSDWRTLIGPTDAR-KAKISH 128
PTZ00093 PTZ00093
nucleoside diphosphate kinase, cytosolic; Provisional
244-335 4.89e-06

nucleoside diphosphate kinase, cytosolic; Provisional


Pssm-ID: 173387  Cd Length: 149  Bit Score: 44.33  E-value: 4.89e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 244 VKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGvVTEYHDMVTEMYSGPCVAMEIQQNNATKTFRE 323
Cdd:PTZ00093   9 VKPDGVQRGLVGEIIKRFEKKGYKLVALKMLQPTPEIAEEHYKEHKG-KPFFPGLVKYISSGPVVCMVWEGKNVVKQGRK 87
                         90
                 ....*....|..
gi 297281474 324 FCGPVDPTPKSP 335
Cdd:PTZ00093  88 LLGATNPLESAP 99
NDK smart00562
Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to ...
92-225 1.34e-61

Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates; These enzymes play important roles in bacterial growth, signal transduction and pathogenicity.


Pssm-ID: 197791 [Multi-domain]  Cd Length: 135  Bit Score: 195.46  E-value: 1.34e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474    92 EKTLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAI 169
Cdd:smart00562   1 ERTLAIIKPDAVQRglIGEIISRFERKGFKIVAMKMLQLTEEQAEEFYAEHEGKPFFNDLVEFMTSGPVVAMVLEGEDAV 80
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 297281474   170 CEWKRLLGPANsgvARTDASGSIRALFGTDGIRNAAHGPDSFASAAREMELFFPSS 225
Cdd:smart00562  81 KTWRTLMGPTD---PREAAPGTIRGDFGLDIGRNAVHGSDSPESAEREIALFFPES 133
NDK pfam00334
Nucleoside diphosphate kinase;
92-225 7.72e-56

Nucleoside diphosphate kinase;


Pssm-ID: 249778 [Multi-domain]  Cd Length: 135  Bit Score: 180.36  E-value: 7.72e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474   92 EKTLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAI 169
Cdd:pfam00334   1 ERTLVIIKPDAVQRglIGEIISRFEKKGFKIVALKMLQLTREQAEEHYAEHKGKPFFPGLVEFMTSGPVVAMVLEGENAV 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 297281474  170 CEWKRLLGPANSGVArtdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFFPSS 225
Cdd:pfam00334  81 SVVRELMGATNPAEA---APGTIRGDFAVSIGRNAVHGSDSPESAEREIALFFPEE 133
NDK smart00562
Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to ...
238-335 3.27e-35

Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates; These enzymes play important roles in bacterial growth, signal transduction and pathogenicity.


Pssm-ID: 197791 [Multi-domain]  Cd Length: 135  Bit Score: 126.13  E-value: 3.27e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474   238 NCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGvVTEYHDMVTEMYSGPCVAMEIQQNNA 317
Cdd:smart00562   1 ERTLAIIKPDAVQRGLIGEIISRFERKGFKIVAMKMLQLTEEQAEEFYAEHEG-KPFFNDLVEFMTSGPVVAMVLEGEDA 79
                           90
                   ....*....|....*...
gi 297281474   318 TKTFREFCGPVDPTPKSP 335
Cdd:smart00562  80 VKTWRTLMGPTDPREAAP 97
NDK pfam00334
Nucleoside diphosphate kinase;
240-330 1.96e-25

Nucleoside diphosphate kinase;


Pssm-ID: 249778 [Multi-domain]  Cd Length: 135  Bit Score: 99.47  E-value: 1.96e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  240 TCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVtEYHDMVTEMYSGPCVAMEIQQNNATK 319
Cdd:pfam00334   3 TLVIIKPDAVQRGLIGEIISRFEKKGFKIVALKMLQLTREQAEEHYAEHKGKP-FFPGLVEFMTSGPVVAMVLEGENAVS 81
                          90
                  ....*....|.
gi 297281474  320 TFREFCGPVDP 330
Cdd:pfam00334  82 VVRELMGATNP 92
PRK14544 PRK14544
nucleoside diphosphate kinase; Provisional
92-222 1.30e-16

nucleoside diphosphate kinase; Provisional


Pssm-ID: 173010 [Multi-domain]  Cd Length: 183  Bit Score: 75.62  E-value: 1.30e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISKA--GEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQS--------------------------- 142
Cdd:PRK14544   4 ERTLVILKPDAVKRGlvGEIISRFEKAGLKIVAMKMVKATPEQIERFYPSSEEwyrsvgnkllkayqelgidprarlgtd 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 143 ------RPFFNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGVArtdASGSIRALFGTDG----------IRNAAH 206
Cdd:PRK14544  84 dpvevgKKVKESLVKYMTSGPIVAMVLKGNRAVEVVRKLVGPTSPHKA---PPGTIRGDYSIDSpdlaaeegrvVYNLVH 160
                        170
                 ....*....|....*.
gi 297281474 207 GPDSFASAAREMELFF 222
Cdd:PRK14544 161 ASDSPEEAEREIKFWF 176
PLN02619 PLN02619
nucleoside-diphosphate kinase
92-222 3.60e-15

nucleoside-diphosphate kinase


Pssm-ID: 178228 [Multi-domain]  Cd Length: 238  Bit Score: 72.57  E-value: 3.60e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISKaGEIIEIINK---AGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDA 168
Cdd:PLN02619  89 ERTFIAIKPDGVQR-GLISEIISRferKGFKLVAIKVVVPSKEFAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWEGEGV 167
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 297281474 169 ICEWKRLLG---PANSgvartdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:PLN02619 168 IKYGRKLIGatdPQKS------EPGTIRGDLAVVVGRNIIHGSDGPETAKDEINLWF 218
PRK14544 PRK14544
nucleoside diphosphate kinase; Provisional
240-335 1.44e-11

nucleoside diphosphate kinase; Provisional


Pssm-ID: 173010 [Multi-domain]  Cd Length: 183  Bit Score: 61.37  E-value: 1.44e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 240 TCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFY----EVYKGVVTE----YHDM------------- 298
Cdd:PRK14544   6 TLVILKPDAVKRGLVGEIISRFEKAGLKIVAMKMVKATPEQIERFYpsseEWYRSVGNKllkaYQELgidprarlgtddp 85
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 297281474 299 -----------VTEMYSGPCVAMEIQQNNATKTFREFCGPVDPTPKSP 335
Cdd:PRK14544  86 vevgkkvkeslVKYMTSGPIVAMVLKGNRAVEVVRKLVGPTSPHKAPP 133
 
Name Accession Description Interval E-value
NDPk7A cd04415
Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate ...
92-222 1.02e-86

Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B. The function of the DM10 domain, which also occurs in multiple copies in other proteins, is unknown. NDPk7 is predominantly expressed in testes, although appreciable amount are also found in liver, heart, brain, ovary, small intestine and spleen. The nm23-H7 gene is located in or near the hereditary prostrate cancer susceptibility locus. Nm23-H7 may be involved in the development of colon and gastric carcinoma, the latter possibly in a type-specific manner.


Pssm-ID: 239878 [Multi-domain]  Cd Length: 131  Bit Score: 259.68  E-value: 1.02e-86
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAICE 171
Cdd:cd04415    1 EKTLALIKPDAYSKIGKIIQIIEDAGFTITKAKMTKLSRKEAQDFYAEHQSKPFYNELVQFMTSGPIVAMELVGDDAISE 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 297281474 172 WKRLLGPANSGVARTDASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:cd04415   81 WRKLLGPTNSSVARSDAPNSIRALFGTDGTRNAAHGSDSVASAARELEFFF 131
NDPk7B cd04412
Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate ...
238-330 6.48e-52

Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B. The function of the DM10 domain, which also occurs in multiple copies in other proteins, is unknown. NDPk7 is predominantly expressed in testes, although appreciable amount are also found in liver, heart, brain, ovary, small intestine and spleen. The nm23-H7 gene is located in or near the hereditary prostrate cancer susceptibility locus. Nm23-H7 may be involved in the development of colon and gastric carcinoma, the latter possibly in a type-specific manner.


Pssm-ID: 239875  Cd Length: 134  Bit Score: 170.12  E-value: 6.48e-52
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 238 NCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNA 317
Cdd:cd04412    1 NCTVCIIKPHAVSHGLLGEILQQILDEGFEITALQMFNLTRANAEEFLEVYKGVVPELPAMVDELTSGPCIALEIAGENA 80
                         90
                 ....*....|...
gi 297281474 318 TKTFREFCGPVDP 330
Cdd:cd04412   81 VKTFREFCGPFDP 93
NDPk cd00595
Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the ...
92-222 7.94e-69

Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation. They are vital for DNA/RNA synthesis, cell division, macromolecular metabolism and growth. The enzymes generate NTPs or their deoxy derivatives by terminal (gamma) phosphotransfer from an NTP such as ATP or GTP to any nucleoside diphosphate (NDP) or its deoxy derivative. The sequence of NDPk has been highly conserved through evolution. There is a single histidine residue conserved in all known NDK isozymes, which is involved in the catalytic mechanism. The first confirmed metastasis suppressor gene was the NDP kinase protein encoded by the nm23 gene. Unicellular organisms generally possess only one gene encoding NDP kinase, while most multicellular organisms possess not only an ortholog that provides most of the NDP kinase enzymatic activity but also multiple divergent paralogous genes. The human genome codes for at least nine NDP kinases and can be classified into two groups, Groups I and II, according to their genomic architecture and distinct enzymatic activity. Group I isoforms (A-D) are well-conserved, catalytically active, and share 58-88% identity between each other, while Group II are more divergent, with only NDPk6 shown to be active. NDP kinases exist in two different quaternary structures; all known eukaryotic enzymes are hexamers, while some bacterial enzymes are tetramers, as in Myxococcus. The hexamer can be viewed as trimer of dimers, while tetramers are dimers of dimers, with the dimerization interface conserved.


Pssm-ID: 238335  Cd Length: 133  Bit Score: 213.75  E-value: 7.94e-69
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAIS--KAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAI 169
Cdd:cd00595    1 ERTLALIKPDAVAegLLGEIIMRIEDAGFEIVAMKELHLTEEQAEEFYVEHKGRPFFPDLVQFMSSGPVVAMILEKDNAV 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 297281474 170 CEWKRLLGPANSGVARTDASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:cd00595   81 GEWREMLGPTNPEIARHLAPGSLRADFGTDVLRNAVHGSDSVESAAREIAFFF 133
NDPk5 cd04418
Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of ...
92-223 3.16e-48

Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species. It belongs to the nm23 Group II genes and appears to differ from the other human NDPks in that it lacks two important catalytic site residues, and thus does not appear to possess NDP kinase activity. NDPk5 confers protection from cell death by Bax and alters the cellular levels of several antioxidant enzymes, including glutathione peroxidase 5 (Gpx5).


Pssm-ID: 239880  Cd Length: 132  Bit Score: 160.68  E-value: 3.16e-48
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAICE 171
Cdd:cd04418    1 ERTLAIIKPDAVHKAEEIEDIILESGFTIVQKRKLQLSPEQCSDFYAEHYGKMFFPHLVAYMSSGPIVAMVLARHNAISY 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 297281474 172 WKRLLGPANSGVARTDASGSIRALFGTDGIRNAAHGPDSFASAAREMELFFP 223
Cdd:cd04418   81 WKELLGPTNSLKAKETHPDSLRAIYGTDDLRNAVHGSDSFSSAEREIRFMFP 132
NDPk_I cd04413
Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large ...
92-222 4.01e-45

Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate. The mammalian nm23/NDP kinase gene family can be divided into two distinct groups. The group I genes encode proteins that generally have highly homologous counterparts in other organisms and possess the classic enzymatic activity of a kinase. This group includes vertebrate NDP kinases A-D (Nm23- H1 to -H4), and its counterparts in bacteria, archea and other eukaryotes. NDP kinases exist in two different quaternary structures; all known eukaryotic enzymes are hexamers, while some bacterial enzymes are tetramers, as in Myxococcus. They possess the NDP kinase active site motif (NXXH[G/A]SD) and the nine residues that are most essential for catalysis.


Pssm-ID: 239876  Cd Length: 130  Bit Score: 152.24  E-value: 4.01e-45
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAI 169
Cdd:cd04413    1 ERTLVIIKPDGVQRglIGEIISRFERKGLKIVALKMLQLTEELAEEHYAEHKGKPFFPELVEFMTSGPVVAMVLEGENAV 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 297281474 170 CEWKRLLGPANSGVArtdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:cd04413   81 KTVRKLMGATNPADA---APGTIRGDFALSIGRNIVHGSDSVESAEREIALWF 130
Ndk COG0105
Nucleoside diphosphate kinase [Nucleotide transport and metabolism]; linked to 3D-structure
92-225 3.81e-44

Nucleoside diphosphate kinase [Nucleotide transport and metabolism]; linked to 3D-structure


Pssm-ID: 223183  Cd Length: 135  Bit Score: 150.01  E-value: 3.81e-44
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISKA--GEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAI 169
Cdd:COG0105    3 ERTLSIIKPDAVKRGliGEIISRFEKKGLKIVALKMVQLSRELAENHYAEHKGKPFFGELVEFITSGPVVAMVLEGENAI 82
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 297281474 170 CEWKRLLGPANSGVArtdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFFPSS 225
Cdd:COG0105   83 SVVRKLMGATNPANA---APGTIRGDFALSVGENVVHGSDSPESAEREIALFFSKS 135
ndk PRK00668
mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated
92-225 1.22e-43

mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated


Pssm-ID: 179085  Cd Length: 134  Bit Score: 148.33  E-value: 1.22e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAI 169
Cdd:PRK00668   2 ERTFSIIKPDAVQRglIGEIISRFEKKGLKIVALKMMQLSRELAEGHYAEHKEKPFFGELVEFMTSGPVVVMVLEGENAI 81
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 297281474 170 CEWKRLLGPANSGVArtdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFFPSS 225
Cdd:PRK00668  82 AKVRELMGATNPAEA---APGTIRGDFALSIGENVVHGSDSPESAAREIALFFSEE 134
NDPk_TX cd04416
NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 ...
92-222 1.31e-43

NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively. Sptrx-2, which has a tissue specific distribution in human testis, has been considered as a member of the nm23 family (nm23-H8) and exhibits a high homology with sea urchin IC1 (intermediate chain-1) protein, a component of the sperm axonemal outer dynein arm complex. Txl-2 is mainly represented in close association with microtubules within tissues with cilia and flagella such as seminiferous epithelium (spermatids) and lung airway epithelium, suggesting possible role in control of microtubule stability and maintenance.


Pssm-ID: 239879  Cd Length: 132  Bit Score: 148.51  E-value: 1.31e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAI-SKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAIC 170
Cdd:cd04416    1 EYTLALIKPDAVaEKKDEILEKIKEAGFEILAQKEMVLTEEQAREFYKEHEEEDYFEDLVEFMTSGPSLILVLSKENAVE 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 297281474 171 EWKRLLGPANSGVARTDASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:cd04416   81 EWRELMGPTDPEEAKEEKPDSLRAQFARDHLSNAVHGSSSAEEAEKEIDFFF 132
NDPk cd00595
Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the ...
238-330 1.46e-43

Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation. They are vital for DNA/RNA synthesis, cell division, macromolecular metabolism and growth. The enzymes generate NTPs or their deoxy derivatives by terminal (gamma) phosphotransfer from an NTP such as ATP or GTP to any nucleoside diphosphate (NDP) or its deoxy derivative. The sequence of NDPk has been highly conserved through evolution. There is a single histidine residue conserved in all known NDK isozymes, which is involved in the catalytic mechanism. The first confirmed metastasis suppressor gene was the NDP kinase protein encoded by the nm23 gene. Unicellular organisms generally possess only one gene encoding NDP kinase, while most multicellular organisms possess not only an ortholog that provides most of the NDP kinase enzymatic activity but also multiple divergent paralogous genes. The human genome codes for at least nine NDP kinases and can be classified into two groups, Groups I and II, according to their genomic architecture and distinct enzymatic activity. Group I isoforms (A-D) are well-conserved, catalytically active, and share 58-88% identity between each other, while Group II are more divergent, with only NDPk6 shown to be active. NDP kinases exist in two different quaternary structures; all known eukaryotic enzymes are hexamers, while some bacterial enzymes are tetramers, as in Myxococcus. The hexamer can be viewed as trimer of dimers, while tetramers are dimers of dimers, with the dimerization interface conserved.


Pssm-ID: 238335  Cd Length: 133  Bit Score: 148.27  E-value: 1.46e-43
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 238 NCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGvVTEYHDMVTEMYSGPCVAMEIQQNNA 317
Cdd:cd00595    1 ERTLALIKPDAVAEGLLGEIIMRIEDAGFEIVAMKELHLTEEQAEEFYVEHKG-RPFFPDLVQFMSSGPVVAMILEKDNA 79
                         90
                 ....*....|...
gi 297281474 318 TKTFREFCGPVDP 330
Cdd:cd00595   80 VGEWREMLGPTNP 92
NDPk6 cd04414
Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced ...
92-223 6.96e-40

Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues. NDPk6 has all nine residues considered crucial for enzyme structure and activity, and has been found to have NDP kinase activity. It may play a role in cell growth and cell cycle progression. The nm23-H6 gene locus has been implicated in a variety of malignant tumors.


Pssm-ID: 239877  Cd Length: 135  Bit Score: 138.69  E-value: 6.96e-40
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAIS---KAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDA 168
Cdd:cd04414    1 QLTLALIKPDAVAhplALEAVRQLILSNGFTIVRKKELRWTTEDAERFYAEHKGKFFYDRLVSFMTSGPSWALILAHENA 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 297281474 169 ICEWKRLLGPANSGVARTDASGSIRALFGTDGIRNAAHGPDSFASAAREMELFFP 223
Cdd:cd04414   81 IKTWRALMGPTKVFRARASAPDSIRGLYGLTDTRNATHGSDSPASAQREIALFFP 135
PLN02931 PLN02931
nucleoside diphosphate kinase family protein
89-222 1.86e-36

nucleoside diphosphate kinase family protein


Pssm-ID: 215503  Cd Length: 177  Bit Score: 131.10  E-value: 1.86e-36
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  89 SRKEKTLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRD 166
Cdd:PLN02931  27 SEEERTLAMIKPDGLSGnyTERIKEVILESGFSIVKEMTTQLDEDRASLFYAEHSSRSFFPSLVKYMTSGPVLVMVLEKE 106
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 297281474 167 DAICEWKRLLGPANSGVARTDASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:PLN02931 107 NAVSDWRTLIGPTDARKAKISHPNSIRAMCGLDSEKNCVHGSDSPESAEREISFFF 162
DM10 smart00676
Domains in hypothetical proteins in Drosophila, C. elegans and mammals. Occurs singly in some ...
3-91 7.97e-32

Domains in hypothetical proteins in Drosophila, C. elegans and mammals. Occurs singly in some nucleoside diphosphate kinases;


Pssm-ID: 128921  Cd Length: 104  Bit Score: 115.87  E-value: 7.97e-32
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474     3 HSERFVFIAEWYDPNA--SLLRRYELLFYPGDGSVEMH--DVKN----HRTFLKRTKY--------DSLHLEDLFIGNKV 66
Cdd:smart00676   1 DKKVLRFDAYWEDPVAmfYLIRRFKIYYYLEDDTIEVFepDVRNsgilQGTFLRRQRVpkpppddpEYYHASDLNVGTTI 80
                           90       100
                   ....*....|....*....|....*
gi 297281474    67 NVFSRQLVLIDYgDQYTARQLGSRK 91
Cdd:smart00676  81 NVFGRQFRIYDC-DEFTRNYLESKG 104
NDPk7B cd04412
Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate ...
94-222 7.98e-31

Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B. The function of the DM10 domain, which also occurs in multiple copies in other proteins, is unknown. NDPk7 is predominantly expressed in testes, although appreciable amount are also found in liver, heart, brain, ovary, small intestine and spleen. The nm23-H7 gene is located in or near the hereditary prostrate cancer susceptibility locus. Nm23-H7 may be involved in the development of colon and gastric carcinoma, the latter possibly in a type-specific manner.


Pssm-ID: 239875  Cd Length: 134  Bit Score: 114.27  E-value: 7.98e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  94 TLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQS-RPFFNELIQFITSGPVIAMEILRDDAIC 170
Cdd:cd04412    3 TVCIIKPHAVSHglLGEILQQILDEGFEITALQMFNLTRANAEEFLEVYKGvVPELPAMVDELTSGPCIALEIAGENAVK 82
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 297281474 171 EWKRLLGPANSGVARTDASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:cd04412   83 TFREFCGPFDPEIAKQLRPNTLRARYGKDKVQNAVHCTDLPEDGPLELKFFF 134
PRK14542 PRK14542
nucleoside diphosphate kinase; Provisional
92-222 5.92e-30

nucleoside diphosphate kinase; Provisional


Pssm-ID: 173008  Cd Length: 137  Bit Score: 112.07  E-value: 5.92e-30
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAI 169
Cdd:PRK14542   2 SRTFIMIKPDGVKNkhVGNILQRIEKEGFKILGLKYLKLSLEDAKQFYKVHSARPFYNDLCNYMSSGPIVAAALERDNAV 81
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 297281474 170 CEWKRLLGPANSGVArtdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:PRK14542  82 LHWREVIGATDPKEA---AAGTIRALYAESKEANAVHGSDSDANAALEISFFF 131
PTZ00093 PTZ00093
nucleoside diphosphate kinase, cytosolic; Provisional
91-222 1.74e-28

nucleoside diphosphate kinase, cytosolic; Provisional


Pssm-ID: 173387  Cd Length: 149  Bit Score: 108.27  E-value: 1.74e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  91 KEKTLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDA 168
Cdd:PTZ00093   2 SERTFIMVKPDGVQRglVGEIIKRFEKKGYKLVALKMLQPTPEIAEEHYKEHKGKPFFPGLVKYISSGPVVCMVWEGKNV 81
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 297281474 169 ICEWKRLLGPANSGVArtdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:PTZ00093  82 VKQGRKLLGATNPLES---APGTIRGDFCVDVGRNVIHGSDSVESAKREIALWF 132
PRK14540 PRK14540
nucleoside diphosphate kinase; Provisional
91-222 2.50e-26

nucleoside diphosphate kinase; Provisional


Pssm-ID: 184733  Cd Length: 134  Bit Score: 101.82  E-value: 2.50e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  91 KEKTLALIKPDAISKA--GEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDA 168
Cdd:PRK14540   2 KERTFVALKPDAVERKliGKIIQRFENKGFEIVEMKMLKLTREMAEEYYEEHKGKEFYERLINFMTSGRIVAMVIEGENA 81
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 297281474 169 ICEWKRLLGPANSGVARtdaSGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:PRK14540  82 ISTVRKMIGKTNPAEAE---PGTIRGDFGLYTPANIIHASDSKESAEREIKLFF 132
PRK14545 PRK14545
nucleoside diphosphate kinase; Provisional
93-222 6.87e-26

nucleoside diphosphate kinase; Provisional


Pssm-ID: 184734  Cd Length: 139  Bit Score: 100.75  E-value: 6.87e-26
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  93 KTLALIKPDAISKA--GEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAIC 170
Cdd:PRK14545   5 RTFTMIKPDAVENGhiGGILDMITAAGFRIVAMKLTQLTVADAETFYAVHAERPFYGELVEFMSRGPIVAAILEKENAVE 84
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 297281474 171 EWKRLLGPANSGVArtdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:PRK14545  85 DFRTLIGATNPADA---AEGTIRKKYAKSIGENAVHGSDSDENAQIEGAFHF 133
PRK14541 PRK14541
nucleoside diphosphate kinase; Provisional
92-222 2.13e-25

nucleoside diphosphate kinase; Provisional


Pssm-ID: 173007  Cd Length: 140  Bit Score: 99.25  E-value: 2.13e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISKA--GEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAI 169
Cdd:PRK14541   2 ERTLTILKPDCVRKQliGAVIDKIERAGFRVVAMKKTRLTKETAGEFYAVHRERPFYGELVEFMSSGPCVPMILEKENAV 81
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|...
gi 297281474 170 CEWKRLLGPANSGVArtdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:PRK14541  82 ADFRTLIGATDPAEA---AEGTVRKLYADSKGENIVHGSDSAENAAIEAGFFF 131
NDPk_I cd04413
Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large ...
240-330 2.77e-19

Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate. The mammalian nm23/NDP kinase gene family can be divided into two distinct groups. The group I genes encode proteins that generally have highly homologous counterparts in other organisms and possess the classic enzymatic activity of a kinase. This group includes vertebrate NDP kinases A-D (Nm23- H1 to -H4), and its counterparts in bacteria, archea and other eukaryotes. NDP kinases exist in two different quaternary structures; all known eukaryotic enzymes are hexamers, while some bacterial enzymes are tetramers, as in Myxococcus. They possess the NDP kinase active site motif (NXXH[G/A]SD) and the nine residues that are most essential for catalysis.


Pssm-ID: 239876  Cd Length: 130  Bit Score: 81.75  E-value: 2.77e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 240 TCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTeYHDMVTEMYSGPCVAMEIQQNNATK 319
Cdd:cd04413    3 TLVIIKPDGVQRGLIGEIISRFERKGLKIVALKMLQLTEELAEEHYAEHKGKPF-FPELVEFMTSGPVVAMVLEGENAVK 81
                         90
                 ....*....|.
gi 297281474 320 TFREFCGPVDP 330
Cdd:cd04413   82 TVRKLMGATNP 92
Ndk COG0105
Nucleoside diphosphate kinase [Nucleotide transport and metabolism]; linked to 3D-structure
240-330 2.57e-17

Nucleoside diphosphate kinase [Nucleotide transport and metabolism]; linked to 3D-structure


Pssm-ID: 223183  Cd Length: 135  Bit Score: 76.44  E-value: 2.57e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 240 TCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTeYHDMVTEMYSGPCVAMEIQQNNATK 319
Cdd:COG0105    5 TLSIIKPDAVKRGLIGEIISRFEKKGLKIVALKMVQLSRELAENHYAEHKGKPF-FGELVEFITSGPVVAMVLEGENAIS 83
                         90
                 ....*....|.
gi 297281474 320 TFREFCGPVDP 330
Cdd:COG0105   84 VVRKLMGATNP 94
ndk PRK00668
mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated
243-330 4.88e-16

mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated


Pssm-ID: 179085  Cd Length: 134  Bit Score: 73.22  E-value: 4.88e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 243 IVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKgvvtE---YHDMVTEMYSGPCVAMEIQQNNATK 319
Cdd:PRK00668   7 IIKPDAVQRGLIGEIISRFEKKGLKIVALKMMQLSRELAEGHYAEHK----EkpfFGELVEFMTSGPVVVMVLEGENAIA 82
                         90
                 ....*....|.
gi 297281474 320 TFREFCGPVDP 330
Cdd:PRK00668  83 KVRELMGATNP 93
NDPk_TX cd04416
NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 ...
239-330 1.88e-15

NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively. Sptrx-2, which has a tissue specific distribution in human testis, has been considered as a member of the nm23 family (nm23-H8) and exhibits a high homology with sea urchin IC1 (intermediate chain-1) protein, a component of the sperm axonemal outer dynein arm complex. Txl-2 is mainly represented in close association with microtubules within tissues with cilia and flagella such as seminiferous epithelium (spermatids) and lung airway epithelium, suggesting possible role in control of microtubule stability and maintenance.


Pssm-ID: 239879  Cd Length: 132  Bit Score: 71.47  E-value: 1.88e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 239 CTCCIVKPHAVSEGLLgKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGvvTEY-HDMVTEMYSGPCVAMEIQQNNA 317
Cdd:cd04416    2 YTLALIKPDAVAEKKD-EILEKIKEAGFEILAQKEMVLTEEQAREFYKEHEE--EDYfEDLVEFMTSGPSLILVLSKENA 78
                         90
                 ....*....|...
gi 297281474 318 TKTFREFCGPVDP 330
Cdd:cd04416   79 VEEWRELMGPTDP 91
PRK14540 PRK14540
nucleoside diphosphate kinase; Provisional
240-335 2.80e-15

nucleoside diphosphate kinase; Provisional


Pssm-ID: 184733  Cd Length: 134  Bit Score: 71.01  E-value: 2.80e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 240 TCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGvvTEYHD-MVTEMYSGPCVAMEIQQNNAT 318
Cdd:PRK14540   5 TFVALKPDAVERKLIGKIIQRFENKGFEIVEMKMLKLTREMAEEYYEEHKG--KEFYErLINFMTSGRIVAMVIEGENAI 82
                         90
                 ....*....|....*..
gi 297281474 319 KTFREFCGPVDPTPKSP 335
Cdd:PRK14540  83 STVRKMIGKTNPAEAEP 99
PRK14541 PRK14541
nucleoside diphosphate kinase; Provisional
240-330 2.75e-13

nucleoside diphosphate kinase; Provisional


Pssm-ID: 173007  Cd Length: 140  Bit Score: 65.74  E-value: 2.75e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 240 TCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGvVTEYHDMVTEMYSGPCVAMEIQQNNATK 319
Cdd:PRK14541   4 TLTILKPDCVRKQLIGAVIDKIERAGFRVVAMKKTRLTKETAGEFYAVHRE-RPFYGELVEFMSSGPCVPMILEKENAVA 82
                         90
                 ....*....|.
gi 297281474 320 TFREFCGPVDP 330
Cdd:PRK14541  83 DFRTLIGATDP 93
PRK14545 PRK14545
nucleoside diphosphate kinase; Provisional
237-330 2.99e-13

nucleoside diphosphate kinase; Provisional


Pssm-ID: 184734  Cd Length: 139  Bit Score: 65.70  E-value: 2.99e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 237 TNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGvVTEYHDMVTEMYSGPCVAMEIQQNN 316
Cdd:PRK14545   3 GNRTFTMIKPDAVENGHIGGILDMITAAGFRIVAMKLTQLTVADAETFYAVHAE-RPFYGELVEFMSRGPIVAAILEKEN 81
                         90
                 ....*....|....
gi 297281474 317 ATKTFREFCGPVDP 330
Cdd:PRK14545  82 AVEDFRTLIGATNP 95
PRK14542 PRK14542
nucleoside diphosphate kinase; Provisional
240-330 2.77e-11

nucleoside diphosphate kinase; Provisional


Pssm-ID: 173008  Cd Length: 137  Bit Score: 60.07  E-value: 2.77e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 240 TCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYkGVVTEYHDMVTEMYSGPCVAMEIQQNNATK 319
Cdd:PRK14542   4 TFIMIKPDGVKNKHVGNILQRIEKEGFKILGLKYLKLSLEDAKQFYKVH-SARPFYNDLCNYMSSGPIVAAALERDNAVL 82
                         90
                 ....*....|.
gi 297281474 320 TFREFCGPVDP 330
Cdd:PRK14542  83 HWREVIGATDP 93
PRK14543 PRK14543
nucleoside diphosphate kinase; Provisional
92-222 5.30e-08

nucleoside diphosphate kinase; Provisional


Pssm-ID: 237749  Cd Length: 169  Bit Score: 50.66  E-value: 5.30e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISKA--GEIIEIINKAGFTITKLKMMMLSRKEAL------DFHVDHqSRPFFNELIQFITSGPVIAMEI 163
Cdd:PRK14543   6 QKTLCIIKPDGVRRGliGNVVSRFERVGLKIVAAKMLLVDRSMAEkhylydDIAVRH-GEAVWKSLIKFISSSPVFVFVV 84
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 297281474 164 LRDDAICEWKRLLGPANSGVArtdASGSIRALFGTD----------GIRNAAHGPDSFASAAREMELFF 222
Cdd:PRK14543  85 EGVESVEVVRKFCGSTEPKLA---IPGTIRGDFSYHsfnyanekgfSVYNVIHASANEDDALREIPIWF 150
NDPk5 cd04418
Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of ...
239-338 5.40e-08

Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species. It belongs to the nm23 Group II genes and appears to differ from the other human NDPks in that it lacks two important catalytic site residues, and thus does not appear to possess NDP kinase activity. NDPk5 confers protection from cell death by Bax and alters the cellular levels of several antioxidant enzymes, including glutathione peroxidase 5 (Gpx5).


Pssm-ID: 239880  Cd Length: 132  Bit Score: 50.13  E-value: 5.40e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 239 CTCCIVKPHAVSEGllGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTEYHdMVTEMYSGPCVAMEIQQNNAT 318
Cdd:cd04418    2 RTLAIIKPDAVHKA--EEIEDIILESGFTIVQKRKLQLSPEQCSDFYAEHYGKMFFPH-LVAYMSSGPIVAMVLARHNAI 78
                         90       100
                 ....*....|....*....|
gi 297281474 319 KTFREFCGPVDpTPKSPISH 338
Cdd:cd04418   79 SYWKELLGPTN-SLKAKETH 97
NDPk6 cd04414
Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced ...
240-327 8.49e-08

Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues. NDPk6 has all nine residues considered crucial for enzyme structure and activity, and has been found to have NDP kinase activity. It may play a role in cell growth and cell cycle progression. The nm23-H6 gene locus has been implicated in a variety of malignant tumors.


Pssm-ID: 239877  Cd Length: 135  Bit Score: 49.70  E-value: 8.49e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 240 TCCIVKPHAVSEGL-LGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVTeYHDMVTEMYSGPCVAMEIQQNNAT 318
Cdd:cd04414    3 TLALIKPDAVAHPLaLEAVRQLILSNGFTIVRKKELRWTTEDAERFYAEHKGKFF-YDRLVSFMTSGPSWALILAHENAI 81

                 ....*....
gi 297281474 319 KTFREFCGP 327
Cdd:cd04414   82 KTWRALMGP 90
PRK14543 PRK14543
nucleoside diphosphate kinase; Provisional
240-335 1.11e-07

nucleoside diphosphate kinase; Provisional


Pssm-ID: 237749  Cd Length: 169  Bit Score: 49.51  E-value: 1.11e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 240 TCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYeVYKGVVTEYHDMVTE-----MYSGPCVAMEIQQ 314
Cdd:PRK14543   8 TLCIIKPDGVRRGLIGNVVSRFERVGLKIVAAKMLLVDRSMAEKHY-LYDDIAVRHGEAVWKslikfISSSPVFVFVVEG 86
                         90       100
                 ....*....|....*....|.
gi 297281474 315 NNATKTFREFCGPVDPTPKSP 335
Cdd:PRK14543  87 VESVEVVRKFCGSTEPKLAIP 107
PLN02931 PLN02931
nucleoside diphosphate kinase family protein
221-338 2.13e-07

nucleoside diphosphate kinase family protein


Pssm-ID: 215503  Cd Length: 177  Bit Score: 49.05  E-value: 2.13e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 221 FFPSSGGCGPANTAKftncTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVvTEYHDMVT 300
Cdd:PLN02931  17 FPIRCSSSGASEEER----TLAMIKPDGLSGNYTERIKEVILESGFSIVKEMTTQLDEDRASLFYAEHSSR-SFFPSLVK 91
                         90       100       110
                 ....*....|....*....|....*....|....*...
gi 297281474 301 EMYSGPCVAMEIQQNNATKTFREFCGPVDPTpKSPISH 338
Cdd:PLN02931  92 YMTSGPVLVMVLEKENAVSDWRTLIGPTDAR-KAKISH 128
PTZ00093 PTZ00093
nucleoside diphosphate kinase, cytosolic; Provisional
244-335 4.89e-06

nucleoside diphosphate kinase, cytosolic; Provisional


Pssm-ID: 173387  Cd Length: 149  Bit Score: 44.33  E-value: 4.89e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 244 VKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGvVTEYHDMVTEMYSGPCVAMEIQQNNATKTFRE 323
Cdd:PTZ00093   9 VKPDGVQRGLVGEIIKRFEKKGYKLVALKMLQPTPEIAEEHYKEHKG-KPFFPGLVKYISSGPVVCMVWEGKNVVKQGRK 87
                         90
                 ....*....|..
gi 297281474 324 FCGPVDPTPKSP 335
Cdd:PTZ00093  88 LLGATNPLESAP 99
NDK smart00562
Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to ...
92-225 1.34e-61

Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates; These enzymes play important roles in bacterial growth, signal transduction and pathogenicity.


Pssm-ID: 197791 [Multi-domain]  Cd Length: 135  Bit Score: 195.46  E-value: 1.34e-61
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474    92 EKTLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAI 169
Cdd:smart00562   1 ERTLAIIKPDAVQRglIGEIISRFERKGFKIVAMKMLQLTEEQAEEFYAEHEGKPFFNDLVEFMTSGPVVAMVLEGEDAV 80
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*.
gi 297281474   170 CEWKRLLGPANsgvARTDASGSIRALFGTDGIRNAAHGPDSFASAAREMELFFPSS 225
Cdd:smart00562  81 KTWRTLMGPTD---PREAAPGTIRGDFGLDIGRNAVHGSDSPESAEREIALFFPES 133
NDK pfam00334
Nucleoside diphosphate kinase;
92-225 7.72e-56

Nucleoside diphosphate kinase;


Pssm-ID: 249778 [Multi-domain]  Cd Length: 135  Bit Score: 180.36  E-value: 7.72e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474   92 EKTLALIKPDAISK--AGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDAI 169
Cdd:pfam00334   1 ERTLVIIKPDAVQRglIGEIISRFEKKGFKIVALKMLQLTREQAEEHYAEHKGKPFFPGLVEFMTSGPVVAMVLEGENAV 80
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 297281474  170 CEWKRLLGPANSGVArtdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFFPSS 225
Cdd:pfam00334  81 SVVRELMGATNPAEA---APGTIRGDFAVSIGRNAVHGSDSPESAEREIALFFPEE 133
NDK smart00562
Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to ...
238-335 3.27e-35

Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates; These enzymes play important roles in bacterial growth, signal transduction and pathogenicity.


Pssm-ID: 197791 [Multi-domain]  Cd Length: 135  Bit Score: 126.13  E-value: 3.27e-35
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474   238 NCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGvVTEYHDMVTEMYSGPCVAMEIQQNNA 317
Cdd:smart00562   1 ERTLAIIKPDAVQRGLIGEIISRFERKGFKIVAMKMLQLTEEQAEEFYAEHEG-KPFFNDLVEFMTSGPVVAMVLEGEDA 79
                           90
                   ....*....|....*...
gi 297281474   318 TKTFREFCGPVDPTPKSP 335
Cdd:smart00562  80 VKTWRTLMGPTDPREAAP 97
NDK pfam00334
Nucleoside diphosphate kinase;
240-330 1.96e-25

Nucleoside diphosphate kinase;


Pssm-ID: 249778 [Multi-domain]  Cd Length: 135  Bit Score: 99.47  E-value: 1.96e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  240 TCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVtEYHDMVTEMYSGPCVAMEIQQNNATK 319
Cdd:pfam00334   3 TLVIIKPDAVQRGLIGEIISRFEKKGFKIVALKMLQLTREQAEEHYAEHKGKP-FFPGLVEFMTSGPVVAMVLEGENAVS 81
                          90
                  ....*....|.
gi 297281474  320 TFREFCGPVDP 330
Cdd:pfam00334  82 VVRELMGATNP 92
PRK14544 PRK14544
nucleoside diphosphate kinase; Provisional
92-222 1.30e-16

nucleoside diphosphate kinase; Provisional


Pssm-ID: 173010 [Multi-domain]  Cd Length: 183  Bit Score: 75.62  E-value: 1.30e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISKA--GEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQS--------------------------- 142
Cdd:PRK14544   4 ERTLVILKPDAVKRGlvGEIISRFEKAGLKIVAMKMVKATPEQIERFYPSSEEwyrsvgnkllkayqelgidprarlgtd 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 143 ------RPFFNELIQFITSGPVIAMEILRDDAICEWKRLLGPANSGVArtdASGSIRALFGTDG----------IRNAAH 206
Cdd:PRK14544  84 dpvevgKKVKESLVKYMTSGPIVAMVLKGNRAVEVVRKLVGPTSPHKA---PPGTIRGDYSIDSpdlaaeegrvVYNLVH 160
                        170
                 ....*....|....*.
gi 297281474 207 GPDSFASAAREMELFF 222
Cdd:PRK14544 161 ASDSPEEAEREIKFWF 176
PLN02619 PLN02619
nucleoside-diphosphate kinase
92-222 3.60e-15

nucleoside-diphosphate kinase


Pssm-ID: 178228 [Multi-domain]  Cd Length: 238  Bit Score: 72.57  E-value: 3.60e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474  92 EKTLALIKPDAISKaGEIIEIINK---AGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITSGPVIAMEILRDDA 168
Cdd:PLN02619  89 ERTFIAIKPDGVQR-GLISEIISRferKGFKLVAIKVVVPSKEFAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWEGEGV 167
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 297281474 169 ICEWKRLLG---PANSgvartdASGSIRALFGTDGIRNAAHGPDSFASAAREMELFF 222
Cdd:PLN02619 168 IKYGRKLIGatdPQKS------EPGTIRGDLAVVVGRNIIHGSDGPETAKDEINLWF 218
PRK14544 PRK14544
nucleoside diphosphate kinase; Provisional
240-335 1.44e-11

nucleoside diphosphate kinase; Provisional


Pssm-ID: 173010 [Multi-domain]  Cd Length: 183  Bit Score: 61.37  E-value: 1.44e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297281474 240 TCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFY----EVYKGVVTE----YHDM------------- 298
Cdd:PRK14544   6 TLVILKPDAVKRGLVGEIISRFEKAGLKIVAMKMVKATPEQIERFYpsseEWYRSVGNKllkaYQELgidprarlgtddp 85
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 297281474 299 -----------VTEMYSGPCVAMEIQQNNATKTFREFCGPVDPTPKSP 335
Cdd:PRK14544  86 vevgkkvkeslVKYMTSGPIVAMVLKGNRAVEVVRKLVGPTSPHKAPP 133
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH