NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|297280195|ref|XP_001115634|]
View 

PREDICTED: mucin-1-like isoform 13 [Macaca mulatta]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SEA smart00200
Domain found in sea urchin sperm protein, enterokinase, agrin; Proposed function of regulating ...
555-678 4.66e-30

Domain found in sea urchin sperm protein, enterokinase, agrin; Proposed function of regulating or binding carbohydrate sidechains.


:

Pssm-ID: 214554  Cd Length: 121  Bit Score: 115.97  E-value: 4.66e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195   555 PQLSLGVSFFFLSFHISNLQFNSSLEDPSTNYYQQLQRDISELFLQIYKQG----DFLGLSNIMFRysSGcglSVVV*** 630
Cdd:smart00200   1 PTQSFGVSLSVLSVEGENLQYSPSLEDPSSEEYQELVRDVEKLLEQIYGKTdlkpDFVGTEVIEFR--NG---SVVVDLG 75
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 297280195   631 *****GTTNVHDVETQFNQRKTEAAsrYNLTISDISVRDVPFPFSAQT 678
Cdd:smart00200  76 LLFNEGVTNGQDVEEDLLQVIKQAA--YSLKITNVNVVDVLDPDSADS 121
 
Name Accession Description Interval E-value
SEA smart00200
Domain found in sea urchin sperm protein, enterokinase, agrin; Proposed function of regulating ...
555-678 4.66e-30

Domain found in sea urchin sperm protein, enterokinase, agrin; Proposed function of regulating or binding carbohydrate sidechains.


Pssm-ID: 214554  Cd Length: 121  Bit Score: 115.97  E-value: 4.66e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195   555 PQLSLGVSFFFLSFHISNLQFNSSLEDPSTNYYQQLQRDISELFLQIYKQG----DFLGLSNIMFRysSGcglSVVV*** 630
Cdd:smart00200   1 PTQSFGVSLSVLSVEGENLQYSPSLEDPSSEEYQELVRDVEKLLEQIYGKTdlkpDFVGTEVIEFR--NG---SVVVDLG 75
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 297280195   631 *****GTTNVHDVETQFNQRKTEAAsrYNLTISDISVRDVPFPFSAQT 678
Cdd:smart00200  76 LLFNEGVTNGQDVEEDLLQVIKQAA--YSLKITNVNVVDVLDPDSADS 121
SEA pfam01390
SEA domain; Domain found in Sea urchin sperm protein, Enterokinase, Agrin (SEA). Proposed ...
561-662 2.79e-12

SEA domain; Domain found in Sea urchin sperm protein, Enterokinase, Agrin (SEA). Proposed function of regulating or binding carbohydrate side chains. Recently a proteolytic activity has been shown for a SEA domain.


Pssm-ID: 250582  Cd Length: 107  Bit Score: 64.32  E-value: 2.79e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  561 VSFFFLSFHISNLQFNSSLEDPSTNYYQQLQRDISELFLQIYKQ----GDFLGLSNIMFRysSGcglSVVV********G 636
Cdd:pfam01390   3 AQVFTGSFRITNLEFSEDLEDPSSPEYKELARKIENLLNEVFKKsslrPGFKGVRVLSFR--PG---SVVVDYTVIFRKP 77
                          90       100
                  ....*....|....*....|....*..
gi 297280195  637 TT-NVHDVETQFNQRKTEAASRYNLTI 662
Cdd:pfam01390  78 SSeNGATVEEALLEQLNQSSNIGNLGI 104
PHA03378 PHA03378
EBNA-3B; Provisional
294-479 6.48e-13

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 71.25  E-value: 6.48e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 294 TTLGHNVTSAPdtSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGST 373
Cdd:PHA03378 677 SPTGANTMLPI--QWAPGTMQPPPRAPTPMRPPAAPPGRAQRPAAATGRARPPAAAPGRARPPAAAPGRARPPAAAPGRA 754
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 374 GPPARVVTSAPDTSAAPGST-------GPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDT 446
Cdd:PHA03378 755 RPPAAAPGRARPPAAAPGAPtpqpppqAPPAPQQRPRGAPTPQPPPQAGPTSMQLMPRAAPGQQGPTKQILRQLLTGGVK 834
                        170       180       190
                 ....*....|....*....|....*....|...
gi 297280195 447 SAAPGSTGPPARVVTSAPDTRPPGSTAPPAHDV 479
Cdd:PHA03378 835 RGRPSLKKPAALERQAAAGPTPSPGSGTSDKIV 867
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
284-476 1.19e-11

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 66.80  E-value: 1.19e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 284 LAMEPATGSATTLGHNVTSAPdtsaaPGSTGPPARVVTSAPDTSAAPGSTGPPArvvtsAPDTSAAPGSTGPPARVVTSA 363
Cdd:PRK07003 356 LAFEPAVTGGGAPGGGVPARV-----AGAVPAPGARAAAAVGASAVPAVTAVTG-----AAGAALAPKAAAAAAATRAEA 425
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 364 PDTSAAPGSTGppARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPgstgPPARVVTSAPDTSAAPGSTGPPA-RVVTS 442
Cdd:PRK07003 426 PPAAPAPPATA--DRGDDAADGDAPVPAKANARASADSRCDERDAQP----PADSGSASAPASDAPPDAAFEPApRAAAP 499
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 297280195 443 APDTSAAPGSTGPPARVVTS---APDTRPPGSTAPPA 476
Cdd:PRK07003 500 SAATPAAVPDARAPAAASREdapAAAAPPAPEARPPT 536
PTZ00436 PTZ00436
60S ribosomal protein L19-like protein; Provisional
305-459 2.25e-08

60S ribosomal protein L19-like protein; Provisional


Pssm-ID: 185616 [Multi-domain]  Cd Length: 357  Bit Score: 55.34  E-value: 2.25e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 305 DTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAP 384
Cdd:PTZ00436 192 DAAAAAAAKQKAAAKKAAAPSGKKSAKAAAPAKAAAAPAKAAAPPAKAAAAPAKAAAAPAKAAAPPAKAAAPPAKAAAPP 271
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 297280195 385 DTSAAP--GSTGPPARVVTSAPDTSAAPGST-GPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARV 459
Cdd:PTZ00436 272 AKAAAPpaKAAAPPAKAAAPPAKAAAAPAKAaAAPAKAAAAPAKAAAPPAKAAAPPAKAATPPAKAAAPPAKAAAAPV 349
PLN02217 PLN02217
probable pectinesterase/pectinesterase inhibitor
331-461 5.08e-08

probable pectinesterase/pectinesterase inhibitor


Pssm-ID: 215130 [Multi-domain]  Cd Length: 670  Bit Score: 55.10  E-value: 5.08e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 331 GSTGPPARVVTSAPDT-SAAPGSTgpparvvTSAPDTSAAPGSTgppaRVVTSAPDTSAAPgSTGPPARVVTSAPDTSA- 408
Cdd:PLN02217 546 GDAWIPGKGVPYIPGLfAGNPGST-------NSTPTGSAASSNT----TFSSDSPSTVVAP-STSPPAGHLGSPPATPSk 613
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 297280195 409 -APGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVT 461
Cdd:PLN02217 614 iVSPSTSPPASHLGSPSTTPSSPESSIKVASTETASPESSIKVASTESSVSMVS 667
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
288-555 1.30e-07

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 54.01  E-value: 1.30e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  288 PATGSATTLGHNVTSAPDT----SAAPGSTGPPARVVTSAPD-TSAAPGSTGPPARVVTSApDTSAAPGSTGPPARVVTS 362
Cdd:pfam05109 457 PASTGPTVSTADPTSGTPTgttsSTLPEDTSPTSRTTSATPNaTSPTPAVTTPNATSPTTQ-KTSDTPNATSPTPIVIGV 535
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  363 APDTSAAP-GSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVT 441
Cdd:pfam05109 536 TTTATSPPtGTTSVPNATSPQVTEESPVNNTNTPVVTSAPSVLTSAVTTGQHGTGSSPTSQQPGIPSSSHSTPRSNSTST 615
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  442 SAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPAHDVTSASDSASGSASTLVHSTTSARATTTPASKSTPFSIPSHHSD 521
Cdd:pfam05109 616 TPLLTSAHPTGGENITEETPSVPSTTHVSTLSPGPGPGTTSQVSGPGNSSTSRYPGEVHVTEGMPNPNATSPSAPSGQKT 695
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|.
gi 297280195  522 TPTTLASHSTK-------TDASSTHHSTVPPFTSSNHSTSP 555
Cdd:pfam05109 696 AVPTVTSTGGKansttkeTSGSTLMASTSPHTNEGAFRTTP 736
UV_excision_repair_protein_RAD23_homolog_A TIGR00601
UV excision repair protein Rad23; All proteins in this family for which functions are known ...
306-476 4.12e-05

UV excision repair protein Rad23; All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273167 [Multi-domain]  Cd Length: 378  Bit Score: 45.27  E-value: 4.12e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  306 TSAAPGSTGPPARVVTSAPdtsaAPGSTGPPArvvtSAPDTSAAPGSTGPPArvvTSAPDTSAAPGSTGPPARVVTSAPD 385
Cdd:TIGR00601  77 PKTGTGKVAPPAATPTSAP----TPTPSPPAS----PASGMSAAPASAVEEK---SPSEESATATAPESPSTSVPSSGSD 145
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  386 TSA--APGSTGPPA--RVVTSAPDTS----AAPGSTGPPARVVTSApdTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPA 457
Cdd:TIGR00601 146 AAStlVVGSERETTieEIMEMGYEREeverALRAAFNNPDRAVEYL--LTGIPEDPEQPEPVQQTAASTAAATTETPQHG 223
                         170
                  ....*....|....*....
gi 297280195  458 RVVTSAPDTRPPGSTAPPA 476
Cdd:TIGR00601 224 SVFEQAAQGGTEQPATEAA 242
 
Name Accession Description Interval E-value
SEA smart00200
Domain found in sea urchin sperm protein, enterokinase, agrin; Proposed function of regulating ...
555-678 4.66e-30

Domain found in sea urchin sperm protein, enterokinase, agrin; Proposed function of regulating or binding carbohydrate sidechains.


Pssm-ID: 214554  Cd Length: 121  Bit Score: 115.97  E-value: 4.66e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195   555 PQLSLGVSFFFLSFHISNLQFNSSLEDPSTNYYQQLQRDISELFLQIYKQG----DFLGLSNIMFRysSGcglSVVV*** 630
Cdd:smart00200   1 PTQSFGVSLSVLSVEGENLQYSPSLEDPSSEEYQELVRDVEKLLEQIYGKTdlkpDFVGTEVIEFR--NG---SVVVDLG 75
                           90       100       110       120
                   ....*....|....*....|....*....|....*....|....*...
gi 297280195   631 *****GTTNVHDVETQFNQRKTEAAsrYNLTISDISVRDVPFPFSAQT 678
Cdd:smart00200  76 LLFNEGVTNGQDVEEDLLQVIKQAA--YSLKITNVNVVDVLDPDSADS 121
SEA pfam01390
SEA domain; Domain found in Sea urchin sperm protein, Enterokinase, Agrin (SEA). Proposed ...
561-662 2.79e-12

SEA domain; Domain found in Sea urchin sperm protein, Enterokinase, Agrin (SEA). Proposed function of regulating or binding carbohydrate side chains. Recently a proteolytic activity has been shown for a SEA domain.


Pssm-ID: 250582  Cd Length: 107  Bit Score: 64.32  E-value: 2.79e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  561 VSFFFLSFHISNLQFNSSLEDPSTNYYQQLQRDISELFLQIYKQ----GDFLGLSNIMFRysSGcglSVVV********G 636
Cdd:pfam01390   3 AQVFTGSFRITNLEFSEDLEDPSSPEYKELARKIENLLNEVFKKsslrPGFKGVRVLSFR--PG---SVVVDYTVIFRKP 77
                          90       100
                  ....*....|....*....|....*..
gi 297280195  637 TT-NVHDVETQFNQRKTEAASRYNLTI 662
Cdd:pfam01390  78 SSeNGATVEEALLEQLNQSSNIGNLGI 104
PHA03378 PHA03378
EBNA-3B; Provisional
294-479 6.48e-13

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 71.25  E-value: 6.48e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 294 TTLGHNVTSAPdtSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGST 373
Cdd:PHA03378 677 SPTGANTMLPI--QWAPGTMQPPPRAPTPMRPPAAPPGRAQRPAAATGRARPPAAAPGRARPPAAAPGRARPPAAAPGRA 754
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 374 GPPARVVTSAPDTSAAPGST-------GPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDT 446
Cdd:PHA03378 755 RPPAAAPGRARPPAAAPGAPtpqpppqAPPAPQQRPRGAPTPQPPPQAGPTSMQLMPRAAPGQQGPTKQILRQLLTGGVK 834
                        170       180       190
                 ....*....|....*....|....*....|...
gi 297280195 447 SAAPGSTGPPARVVTSAPDTRPPGSTAPPAHDV 479
Cdd:PHA03378 835 RGRPSLKKPAALERQAAAGPTPSPGSGTSDKIV 867
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
297-555 4.34e-12

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 68.66  E-value: 4.34e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  297 GHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPG--STGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTG 374
Cdd:PHA03307   48 AELAAVTVVAGAAACDRFEPPTGPPPGPGTEAPANesRSTPTWSLSTLAPASPAREGSPTPPGPSSPDPPPPTPPPASPP 127
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  375 P-PARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPP--ARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPG 451
Cdd:PHA03307  128 PsPAPDLSEMLRPVGSPGPPPAASPPAAGASPAAVASDAASSRqaALPLSSPEETARAPSSPPAEPPPSTPPAAASPRPP 207
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  452 STGPPARVVTSAPDTRPPGSTAPPAHDVTSASDSASGSASTLVHSTTSARATTTPASKSTPFSIPSHHSDTPTTLASHST 531
Cdd:PHA03307  208 RRSSPISASASSPAPAPGRSAADDAGASSSDSSSSESSGCGWGPENECPLPRPAPITLPTRIWEASGWNGPSSRPGPASS 287
                         250       260
                  ....*....|....*....|....
gi 297280195  532 KTDASSTHHSTVPPFTSSNHSTSP 555
Cdd:PHA03307  288 SSSPRERSPSPSPSSPGSGPAPSS 311
PHA03247 PHA03247
large tegument protein UL36; Provisional
198-476 1.07e-11

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 67.66  E-value: 1.07e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  198 PTQSTTTMTPG----------TQSPFFLLLILTVLTVVTGSGHTNSTPGGEKETSATQRSSMPISTKNAVSMTSRLSSHS 267
Cdd:PHA03247 2592 PPQSARPRAPVddrgdprgpaPPSPLPPDTHAPDPPPPSPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLG 2671
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  268 PVSGSSTTQGQDVTLALamEPATGSATTLGhnvtSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTS 347
Cdd:PHA03247 2672 RAAQASSPPQRPRRRAA--RPTVGSLTSLA----DPPPPPPTPEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVP 2745
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  348 AAPGSTGPPARVvTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPAR-VVTSAPDTSAAPGSTGPPARVVTsaPDT 426
Cdd:PHA03247 2746 AGPATPGGPARP-ARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESReSLPSPWDPADPPAAVLAPAAALP--PAA 2822
                         250       260       270       280       290
                  ....*....|....*....|....*....|....*....|....*....|.
gi 297280195  427 SAAPGSTGPPARVVTSAPDTSAAPGSTGPP-ARVVTSAPDTRPPGSTAPPA 476
Cdd:PHA03247 2823 SPAGPLPPPTSAQPTAPPPPPGPPPPSLPLgGSVAPGGDVRRRPPSRSPAA 2873
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
284-476 1.19e-11

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 66.80  E-value: 1.19e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 284 LAMEPATGSATTLGHNVTSAPdtsaaPGSTGPPARVVTSAPDTSAAPGSTGPPArvvtsAPDTSAAPGSTGPPARVVTSA 363
Cdd:PRK07003 356 LAFEPAVTGGGAPGGGVPARV-----AGAVPAPGARAAAAVGASAVPAVTAVTG-----AAGAALAPKAAAAAAATRAEA 425
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 364 PDTSAAPGSTGppARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPgstgPPARVVTSAPDTSAAPGSTGPPA-RVVTS 442
Cdd:PRK07003 426 PPAAPAPPATA--DRGDDAADGDAPVPAKANARASADSRCDERDAQP----PADSGSASAPASDAPPDAAFEPApRAAAP 499
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 297280195 443 APDTSAAPGSTGPPARVVTS---APDTRPPGSTAPPA 476
Cdd:PRK07003 500 SAATPAAVPDARAPAAASREdapAAAAPPAPEARPPT 536
PHA03247 PHA03247
large tegument protein UL36; Provisional
196-558 1.21e-11

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 67.27  E-value: 1.21e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  196 PLPTQSTTTMTPGTQSPFFLLLILTVLTVVTGSGHTNSTPGGEKETSATQRSSMPISTKNAVSMTSRLSSHSPVSGSSTT 275
Cdd:PHA03247 2712 PHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASL 2791
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  276 QGQDVTLALAMEPATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGP 355
Cdd:PHA03247 2792 SESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPPSRSP 2871
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  356 PARVVTSA-------------PDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPParvvts 422
Cdd:PHA03247 2872 AAKPAAPArppvrrlarpavsRSTESFALPPDQPERPPQPQAPPPPQPQPQPPPPPQPQPPPPPPPRPQPPLAP------ 2945
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  423 APDTSAAPGSTGpparVVTSAPDTSAAPGSTGPPARVVTSAPDTRP-PGSTAPPAHDVTSASDSASGSASTLvhsttSAR 501
Cdd:PHA03247 2946 TTDPAGAGEPSG----AVPQPWLGALVPGRVAVPRFRVPQPAPSREaPASSTPPLTGHSLSRVSSWASSLAL-----HEE 3016
                         330       340       350       360       370
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 297280195  502 ATTTPASKSTPFSIPS--HHSDTPTTLASHSTKTDASSTHHSTVPPFTSSNHSTSPQLS 558
Cdd:PHA03247 3017 TDPPPVSLKQTLWPPDdtEDSDADSLFDSDSERSDLEALDPLPPEPHDPFAHEPDPATP 3075
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
299-476 1.54e-11

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 66.55  E-value: 1.54e-11
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 299 NVTSAPDTSAAPGsTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPAR 378
Cdd:PRK07764 585 EAVVGPAPGAAGG-EGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDAS 663
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 379 VVTS---APDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARvVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGP 455
Cdd:PRK07764 664 DGGDgwpAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPA-ATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLP 742
                        170       180
                 ....*....|....*....|.
gi 297280195 456 PARVVTSAPDTRPPGSTAPPA 476
Cdd:PRK07764 743 PEPDDPPDPAGAPAQPPPPPA 763
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
303-478 1.44e-10

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 63.33  E-value: 1.44e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 303 APDTSAapGSTGPPARVVTSAPdtsAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPdtsAAPGSTGPPARVVTS 382
Cdd:PRK07003 341 APDEYA--GFTMTLLRMLAFEP---AVTGGGAPGGGVPARVAGAVPAPGARAAAAVGASAVP---AVTAVTGAAGAALAP 412
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 383 APDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAP-GSTGPPARVVT 461
Cdd:PRK07003 413 KAAAAAAATRAEAPPAAPAPPATADRGDDAADGDAPVPAKANARASADSRCDERDAQPPADSGSASAPaSDAPPDAAFEP 492
                        170
                 ....*....|....*..
gi 297280195 462 SAPDTRPPGSTAPPAHD 478
Cdd:PRK07003 493 APRAAAPSAATPAAVPD 509
PHA03247 PHA03247
large tegument protein UL36; Provisional
302-512 2.72e-10

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 63.03  E-value: 2.72e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  302 SAPDTSAAPGSTGPPARVVTSAPDTSAAPGStGPPARVVTSAPDTSAAPGSTGPP--ARVVTSAPDTSAAPGSTGPPARV 379
Cdd:PHA03247 2611 PAPPSPLPPDTHAPDPPPPSPSPAANEPDPH-PPPTVPPPERPRDDPAPGRVSRPrrARRLGRAAQASSPPQRPRRRAAR 2689
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  380 VTSAPDTSAA-----PGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSA-PDTSAAPGST 453
Cdd:PHA03247 2690 PTVGSLTSLAdppppPPTPEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGGPARPArPPTTAGPPAP 2769
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 297280195  454 GPPARVVTSAPD--TRPPGSTAPPAHDVTSASDSASGSASTLVHSTTSARATTTPASKSTP 512
Cdd:PHA03247 2770 APPAAPAAGPPRrlTRPAVASLSESRESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPP 2830
PHA03247 PHA03247
large tegument protein UL36; Provisional
287-555 2.96e-10

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 62.65  E-value: 2.96e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  287 EPATGSATTLghnvTSAPDTSAAPGSTG-PPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGStGPPARVVTSAPD 365
Cdd:PHA03247 2579 EPAVTSRARR----PDAPPQSARPRAPVdDRGDPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPH-PPPTVPPPERPR 2653
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  366 TSAAPGSTGPP--ARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAA--------PGSTGPPARVVTSAPDTSAAPGSTGP 435
Cdd:PHA03247 2654 DDPAPGRVSRPrrARRLGRAAQASSPPQRPRRRAARPTVGSLTSLAdpppppptPEPAPHALVSATPLPPGPAAARQASP 2733
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  436 PARVVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPAHDVTSASDSASGSASTLvhsttsarattTPASKSTPfsI 515
Cdd:PHA03247 2734 ALPAAPAPPAVPAGPATPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASL-----------SESRESLP--S 2800
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|
gi 297280195  516 PSHHSDTPTTLASHSTKTDASSTHHSTVPPFTSSNHSTSP 555
Cdd:PHA03247 2801 PWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPP 2840
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
303-554 3.09e-10

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 62.50  E-value: 3.09e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  303 APDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARvvTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTS 382
Cdd:PHA03307   81 ANESRSTPTWSLSTLAPASPAREGSPTPPGPSSPDP--PPPTPPPASPPPSPAPDLSEMLRPVGSPGPPPAASPPAAGAS 158
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  383 APDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTS 462
Cdd:PHA03307  159 PAAVASDAASSRQAALPLSSPEETARAPSSPPAEPPPSTPPAAASPRPPRRSSPISASASSPAPAPGRSAADDAGASSSD 238
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  463 APDTRPPGSTAPPaHDVTSASDSASGSASTLVHSTTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHST 542
Cdd:PHA03307  239 SSSSESSGCGWGP-ENECPLPRPAPITLPTRIWEASGWNGPSSRPGPASSSSSPRERSPSPSPSSPGSGPAPSSPRASSS 317
                         250
                  ....*....|..
gi 297280195  543 VPPFTSSNHSTS 554
Cdd:PHA03307  318 SSSSRESSSSST 329
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
283-480 3.26e-10

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 62.31  E-value: 3.26e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 283 ALAMEPATGSATTLGHNVTSAPDTSAAPGSTGPPARvvtsaPDTSAAPGST-GPPARVVTSAPDTSAAPGSTGPPARVVT 361
Cdd:PRK07764 594 AAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAP-----AGAAAAPAEAsAAPAPGVAAPEHHPKHVAVPDASDGGDG 668
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 362 SAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARvvT 441
Cdd:PRK07764 669 WPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPPEP--D 746
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 297280195 442 SAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPAHDVT 480
Cdd:PRK07764 747 DPPDPAGAPAQPPPPPAPAPAAAPAAAPPPSPPSEEEEM 785
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
283-472 4.93e-10

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 61.79  E-value: 4.93e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 283 ALAMEPATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTS 362
Cdd:PRK07003 393 ASAVPAVTAVTGAAGAALAPKAAAAAAATRAEAPPAAPAPPATADRGDDAADGDAPVPAKANARASADSRCDERDAQPPA 472
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 363 APDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARV-----VTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPA 437
Cdd:PRK07003 473 DSGSASAPASDAPPDAAFEPAPRAAAPSAATPAAVPDarapaAASREDAPAAAAPPAPEARPPTPAAAAPAARAGGAAAA 552
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|...
gi 297280195 438 ----------------RVVTSAPDTSAAPGSTGPPA--RVVTSAPDTRPPGST 472
Cdd:PRK07003 553 ldvlrnagmrvssdrgARAAAAAKPAAAPAAAPKPAapRVAVQVPTPRARAAT 605
PHA03247 PHA03247
large tegument protein UL36; Provisional
303-523 7.53e-09

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 58.03  E-value: 7.53e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  303 APDTSAA---PGSTGPPARVVTSAPDTSAAPGSTGPP--ARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAA-----PGS 372
Cdd:PHA03247 2628 PPSPSPAanePDPHPPPTVPPPERPRDDPAPGRVSRPrrARRLGRAAQASSPPQRPRRRAARPTVGSLTSLAdppppPPT 2707
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  373 TGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPA--RVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAP 450
Cdd:PHA03247 2708 PEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPATPGgpARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPA 2787
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 297280195  451 GSTGPPARvvTSAPDTRPPGSTAPPAHDVTSASDSASGSASTLVHSTTSARATTTPASKSTPFSIPSHHSDTP 523
Cdd:PHA03247 2788 VASLSESR--ESLPSPWDPADPPAAVLAPAAALPPAASPAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAP 2858
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
320-477 8.93e-09

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 57.69  E-value: 8.93e-09
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 320 VTSAPDTSAAPGsTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARV 399
Cdd:PRK07764 586 AVVGPAPGAAGG-EGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASD 664
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 400 VTS---APDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARvVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPA 476
Cdd:PRK07764 665 GGDgwpAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPA-ATPPAGQADDPAAQPPQAAQGASAPSPAADDPVPLPP 743

                 .
gi 297280195 477 H 477
Cdd:PRK07764 744 E 744
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
274-476 1.38e-08

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 57.10  E-value: 1.38e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  274 TTQGQDVTLALAMEPATGSATTLGHNVTSAPDTSAAPGSTGPPA----------------RVVTSAPDTSAAPG------ 331
Cdd:PHA03307   87 TPTWSLSTLAPASPAREGSPTPPGPSSPDPPPPTPPPASPPPSPapdlsemlrpvgspgpPPAASPPAAGASPAavasda 166
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  332 -STGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAP 410
Cdd:PHA03307  167 aSSRQAALPLSSPEETARAPSSPPAEPPPSTPPAAASPRPPRRSSPISASASSPAPAPGRSAADDAGASSSDSSSSESSG 246
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 297280195  411 GSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPA 476
Cdd:PHA03307  247 CGWGPENECPLPRPAPITLPTRIWEASGWNGPSSRPGPASSSSSPRERSPSPSPSSPGSGPAPSSP 312
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
280-479 1.61e-08

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 56.78  E-value: 1.61e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 280 VTLALAMEPATGSATTLGHNVTSAPDTSAAPGSTG-------------PPARVVTSAPDTSAAPGSTGPPArvvtsAPDT 346
Cdd:PRK07003 402 VTGAAGAALAPKAAAAAAATRAEAPPAAPAPPATAdrgddaadgdapvPAKANARASADSRCDERDAQPPA-----DSGS 476
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 347 SAAPGSTGPPARVVTSAPDTSAAPGSTGPPARV-----VTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPA---- 417
Cdd:PRK07003 477 ASAPASDAPPDAAFEPAPRAAAPSAATPAAVPDarapaAASREDAPAAAAPPAPEARPPTPAAAAPAARAGGAAAAldvl 556
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 297280195 418 ------------RVVTSAPDTSAAPGSTGPPA--RVVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPAHDV 479
Cdd:PRK07003 557 rnagmrvssdrgARAAAAAKPAAAPAAAPKPAapRVAVQVPTPRARAATGDAPPNGAARAEQAAESRGAPPPWEDI 632
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
282-480 2.20e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 56.42  E-value: 2.20e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 282 LALAMEPATGSATTL---------GHNVTSAPDT-SAAPGSTGPPARVVTSA--PDTSAAPGSTGPPARVVTSAPDTSAA 349
Cdd:PRK12323 343 LALAPDEYAGFTMTLlrmlafrpgQSGGGAGPATaAAAPVAQPAPAAAAPAAaaPAPAAPPAAPAAAPAAAAAARAVAAA 422
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 350 PGSTGPPARVVTSAPDTSA-APGSTGPPARVVTSAPDTSAAPGSTGPPARVVT-------SAPDTSAAPGSTGPP----- 416
Cdd:PRK12323 423 PARRSPAPEALAAARQASArGPGGAPAPAPAPAAAPAAAARPAAAGPRPVAAAaaaaparAAPAAAPAPADDDPPpweel 502
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 297280195 417 --ARVVTSAPDTSAAPG-----STGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPAHDVT 480
Cdd:PRK12323 503 ppEFASPAPAQPDAAPAgwvaeSIPDPATADPDDAFETLAPAPAAAPAPRAAAATEPVVAPRPPRASASGL 573
PTZ00436 PTZ00436
60S ribosomal protein L19-like protein; Provisional
305-459 2.25e-08

60S ribosomal protein L19-like protein; Provisional


Pssm-ID: 185616 [Multi-domain]  Cd Length: 357  Bit Score: 55.34  E-value: 2.25e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 305 DTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAP 384
Cdd:PTZ00436 192 DAAAAAAAKQKAAAKKAAAPSGKKSAKAAAPAKAAAAPAKAAAPPAKAAAAPAKAAAAPAKAAAPPAKAAAPPAKAAAPP 271
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 297280195 385 DTSAAP--GSTGPPARVVTSAPDTSAAPGST-GPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARV 459
Cdd:PTZ00436 272 AKAAAPpaKAAAPPAKAAAPPAKAAAAPAKAaAAPAKAAAAPAKAAAPPAKAAAPPAKAATPPAKAAAPPAKAAAAPV 349
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
284-424 3.35e-08

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 55.49  E-value: 3.35e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 284 LAMEPATGSAttlghNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSA 363
Cdd:PRK14951 362 LAFKPAAAAE-----AAAPAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPPAPVAAPAAAAPAA 436
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 297280195 364 PDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPgstgPPARVVTSAP 424
Cdd:PRK14951 437 APAAAPAAVALAPAPPAQAAPETVAIPVRVAPEPAVASAAPAPAAAP----AAARLTPTEE 493
PLN02217 PLN02217
probable pectinesterase/pectinesterase inhibitor
331-461 5.08e-08

probable pectinesterase/pectinesterase inhibitor


Pssm-ID: 215130 [Multi-domain]  Cd Length: 670  Bit Score: 55.10  E-value: 5.08e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 331 GSTGPPARVVTSAPDT-SAAPGSTgpparvvTSAPDTSAAPGSTgppaRVVTSAPDTSAAPgSTGPPARVVTSAPDTSA- 408
Cdd:PLN02217 546 GDAWIPGKGVPYIPGLfAGNPGST-------NSTPTGSAASSNT----TFSSDSPSTVVAP-STSPPAGHLGSPPATPSk 613
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 297280195 409 -APGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVT 461
Cdd:PLN02217 614 iVSPSTSPPASHLGSPSTTPSSPESSIKVASTETASPESSIKVASTESSVSMVS 667
PLN02217 PLN02217
probable pectinesterase/pectinesterase inhibitor
311-441 5.08e-08

probable pectinesterase/pectinesterase inhibitor


Pssm-ID: 215130 [Multi-domain]  Cd Length: 670  Bit Score: 55.10  E-value: 5.08e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 311 GSTGPPARVVTSAPDT-SAAPGSTgpparvvTSAPDTSAAPGSTgppaRVVTSAPDTSAAPgSTGPPARVVTSAPDTSA- 388
Cdd:PLN02217 546 GDAWIPGKGVPYIPGLfAGNPGST-------NSTPTGSAASSNT----TFSSDSPSTVVAP-STSPPAGHLGSPPATPSk 613
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 297280195 389 -APGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVT 441
Cdd:PLN02217 614 iVSPSTSPPASHLGSPSTTPSSPESSIKVASTETASPESSIKVASTESSVSMVS 667
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
323-516 5.85e-08

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 54.86  E-value: 5.85e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 323 APDTSAapGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTS 402
Cdd:PRK07003 341 APDEYA--GFTMTLLRMLAFEPAVTGGGAPGGGVPARVAGAVPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAA 418
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 403 APDTSAAPGSTGPPA----RVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTgpPARVVTSAPDTRPPGSTAPPAHD 478
Cdd:PRK07003 419 AATRAEAPPAAPAPPatadRGDDAADGDAPVPAKANARASADSRCDERDAQPPAD--SGSASAPASDAPPDAAFEPAPRA 496
                        170       180       190
                 ....*....|....*....|....*....|....*...
gi 297280195 479 VTSASDSASGSASTLVHSTTSARATTTPASKSTPFSIP 516
Cdd:PRK07003 497 AAPSAATPAAVPDARAPAAASREDAPAAAAPPAPEARP 534
PLN02217 PLN02217
probable pectinesterase/pectinesterase inhibitor
307-421 7.66e-08

probable pectinesterase/pectinesterase inhibitor


Pssm-ID: 215130 [Multi-domain]  Cd Length: 670  Bit Score: 54.32  E-value: 7.66e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 307 SAAPGSTgpparvvTSAPDTSAAPGSTgppaRVVTSAPDTSAAPgSTGPPARVVTSAPDTSA--APGSTGPPARVVTSAP 384
Cdd:PLN02217 563 AGNPGST-------NSTPTGSAASSNT----TFSSDSPSTVVAP-STSPPAGHLGSPPATPSkiVSPSTSPPASHLGSPS 630
                         90       100       110
                 ....*....|....*....|....*....|....*..
gi 297280195 385 DTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVT 421
Cdd:PLN02217 631 TTPSSPESSIKVASTETASPESSIKVASTESSVSMVS 667
PLN02217 PLN02217
probable pectinesterase/pectinesterase inhibitor
297-401 8.94e-08

probable pectinesterase/pectinesterase inhibitor


Pssm-ID: 215130 [Multi-domain]  Cd Length: 670  Bit Score: 54.32  E-value: 8.94e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 297 GHNVTSAPDTSAAPGSTgppaRVVTSAPDTSAAPgSTGPPARVVTSAPDTSA--APGSTGPPARVVTSAPDTSAAPGSTG 374
Cdd:PLN02217 566 PGSTNSTPTGSAASSNT----TFSSDSPSTVVAP-STSPPAGHLGSPPATPSkiVSPSTSPPASHLGSPSTTPSSPESSI 640
                         90       100
                 ....*....|....*....|....*..
gi 297280195 375 PPARVVTSAPDTSAAPGSTGPPARVVT 401
Cdd:PLN02217 641 KVASTETASPESSIKVASTESSVSMVS 667
PTZ00436 PTZ00436
60S ribosomal protein L19-like protein; Provisional
325-480 1.03e-07

60S ribosomal protein L19-like protein; Provisional


Pssm-ID: 185616 [Multi-domain]  Cd Length: 357  Bit Score: 53.42  E-value: 1.03e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 325 DTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAP 404
Cdd:PTZ00436 192 DAAAAAAAKQKAAAKKAAAPSGKKSAKAAAPAKAAAAPAKAAAPPAKAAAAPAKAAAAPAKAAAPPAKAAAPPAKAAAPP 271
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 405 DTSAAP--GSTGPPARVVTSAPDTSAAPGST-GPPARVVTSAPDTSAAPGST-GPPARVVTSapdtrPPGSTAPPAHDVT 480
Cdd:PTZ00436 272 AKAAAPpaKAAAPPAKAAAPPAKAAAAPAKAaAAPAKAAAAPAKAAAPPAKAaAPPAKAATP-----PAKAAAPPAKAAA 346
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
303-444 1.08e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 53.95  E-value: 1.08e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 303 APDTSAA------------PGSTGPPArvvTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAP 370
Cdd:PRK14951 347 APDEYAAltmvllrllafkPAAAAEAA---APAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPP 423
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 297280195 371 GSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPgstgPPARVVTSAP 444
Cdd:PRK14951 424 APVAAPAAAAPAAAPAAAPAAVALAPAPPAQAAPETVAIPVRVAPEPAVASAAPAPAAAP----AAARLTPTEE 493
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
323-464 1.08e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 53.95  E-value: 1.08e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 323 APDTSAA------------PGSTGPPArvvTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAP 390
Cdd:PRK14951 347 APDEYAAltmvllrllafkPAAAAEAA---APAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPP 423
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 297280195 391 GSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPgstgPPARVVTSAP 464
Cdd:PRK14951 424 APVAAPAAAAPAAAPAAAPAAVALAPAPPAQAAPETVAIPVRVAPEPAVASAAPAPAAAP----AAARLTPTEE 493
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
288-555 1.30e-07

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 54.01  E-value: 1.30e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  288 PATGSATTLGHNVTSAPDT----SAAPGSTGPPARVVTSAPD-TSAAPGSTGPPARVVTSApDTSAAPGSTGPPARVVTS 362
Cdd:pfam05109 457 PASTGPTVSTADPTSGTPTgttsSTLPEDTSPTSRTTSATPNaTSPTPAVTTPNATSPTTQ-KTSDTPNATSPTPIVIGV 535
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  363 APDTSAAP-GSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVT 441
Cdd:pfam05109 536 TTTATSPPtGTTSVPNATSPQVTEESPVNNTNTPVVTSAPSVLTSAVTTGQHGTGSSPTSQQPGIPSSSHSTPRSNSTST 615
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  442 SAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPAHDVTSASDSASGSASTLVHSTTSARATTTPASKSTPFSIPSHHSD 521
Cdd:pfam05109 616 TPLLTSAHPTGGENITEETPSVPSTTHVSTLSPGPGPGTTSQVSGPGNSSTSRYPGEVHVTEGMPNPNATSPSAPSGQKT 695
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|.
gi 297280195  522 TPTTLASHSTK-------TDASSTHHSTVPPFTSSNHSTSP 555
Cdd:pfam05109 696 AVPTVTSTGGKansttkeTSGSTLMASTSPHTNEGAFRTTP 736
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
288-459 1.37e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 53.84  E-value: 1.37e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 288 PATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTS 367
Cdd:PRK07764 635 APAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAATPPAGQA 714
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 368 AAPGSTGPPARVVTSAPDTSAAPGSTGPPArvvTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDT- 446
Cdd:PRK07764 715 DDPAAQPPQAAQGASAPSPAADDPVPLPPE---PDDPPDPAGAPAQPPPPPAPAPAAAPAAAPPPSPPSEEEEMAEDDAp 791
                        170
                 ....*....|...
gi 297280195 447 SAAPGSTGPPARV 459
Cdd:PRK07764 792 SMDDEDRRDAEEV 804
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
289-476 1.98e-07

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 53.25  E-value: 1.98e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  289 ATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSA----- 363
Cdd:PHA03307  165 DAASSRQAALPLSSPEETARAPSSPPAEPPPSTPPAAASPRPPRRSSPISASASSPAPAPGRSAADDAGASSSDSssses 244
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  364 ---------------PDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSA 428
Cdd:PHA03307  245 sgcgwgpenecplprPAPITLPTRIWEASGWNGPSSRPGPASSSSSPRERSPSPSPSSPGSGPAPSSPRASSSSSSSRES 324
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 297280195  429 APGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPA 476
Cdd:PHA03307  325 SSSSTSSSSESSRGAAVSPGPSPSRSPSPSRPPPPADPSSPRKRPRPS 372
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
311-430 2.70e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 52.68  E-value: 2.70e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 311 GSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAP 390
Cdd:PRK07764 389 GGAGAPAAAAPSAAAAAPAAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQPAP 468
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 297280195 391 GSTGPPARVVTSAPDTSAAPGSTGPPArvVTSAPDTSAAP 430
Cdd:PRK07764 469 APAAAPEPTAAPAPAPPAAPAPAAAPA--APAAPAAPAGA 506
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
331-450 2.70e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 52.68  E-value: 2.70e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 331 GSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAP 410
Cdd:PRK07764 389 GGAGAPAAAAPSAAAAAPAAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQPAP 468
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 297280195 411 GSTGPPARVVTSAPDTSAAPGSTGPPArvVTSAPDTSAAP 450
Cdd:PRK07764 469 APAAAPEPTAAPAPAPPAAPAPAAAPA--APAAPAAPAGA 506
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
343-476 4.22e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 52.02  E-value: 4.22e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 343 APDTSAA------------PGSTGPPArvvTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAP 410
Cdd:PRK14951 347 APDEYAAltmvllrllafkPAAAAEAA---APAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPP 423
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 297280195 411 GSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPParvvTSAPDTRPPGSTAPPA 476
Cdd:PRK14951 424 APVAAPAAAAPAAAPAAAPAAVALAPAPPAQAAPETVAIPVRVAPE----PAVASAAPAPAAAPAA 485
PRK12323 PRK12323
DNA polymerase III subunits gamma and tau; Provisional
278-468 4.34e-07

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237057 [Multi-domain]  Cd Length: 700  Bit Score: 52.19  E-value: 4.34e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 278 QDVTLALAMEPATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTS--AAPGSTGP 355
Cdd:PRK12323 384 QPAPAAAAPAAAAPAPAAPPAAPAAAPAAAAAARAVAAAPARRSPAPEALAAARQASARGPGGAPAPAPApaAAPAAAAR 463
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 356 PArVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGP 435
Cdd:PRK12323 464 PA-AAGPRPVAAAAAAAPARAAPAAAPAPADDDPPPWEELPPEFASPAPAQPDAAPAGWVAESIPDPATADPDDAFETLA 542
                        170       180       190
                 ....*....|....*....|....*....|...
gi 297280195 436 PARVVTSAPDTSAAPGSTGPPARVVTSAPDTRP 468
Cdd:PRK12323 543 PAPAAAPAPRAAAATEPVVAPRPPRASASGLPD 575
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
307-429 4.74e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 51.91  E-value: 4.74e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 307 SAAPGSTGPPARvvtSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDT 386
Cdd:PRK07764 391 AGAPAAAAPSAA---AAAPAAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQPA 467
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 297280195 387 SAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAA 429
Cdd:PRK07764 468 PAPAAAPEPTAAPAPAPPAAPAPAAAPAAPAAPAAPAGADDAA 510
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
355-480 6.79e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 51.53  E-value: 6.79e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 355 PPARVVTSAPDTSAAPG-STGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARV---VTSAPDTSAAP 430
Cdd:PRK07764 381 LERRLGVAGGAGAPAAAaPSAAAAAPAAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPAPPSPAGnapAGGAPSPPPAA 460
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 297280195 431 GSTGPPARVVTSAPDTSAAPGSTGPPARvvTSAPDTRPPGSTAPPAHDVT 480
Cdd:PRK07764 461 APSAQPAPAPAAAPEPTAAPAPAPPAAP--APAAAPAAPAAPAAPAGADD 508
PRK12372 PRK12372
ribonuclease III; Reviewed
310-467 7.18e-07

ribonuclease III; Reviewed


Pssm-ID: 237081 [Multi-domain]  Cd Length: 413  Bit Score: 51.06  E-value: 7.18e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 310 PGSTGPPARVVTSAPDT---SAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSA-PDTSAAPGStgppaRVVTSAPD 385
Cdd:PRK12372 249 PGVKGVQEALDLRSPERkerAAAREARAAAAAPAATAAAAAPAEEPAVAPMAAIRAAhVETAADKGE-----RAAKPAAA 323
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 386 TSAAPGSTGPPARVVTSA--PDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSA 463
Cdd:PRK12372 324 DKAADKPADRPDAAEKAAekPAEAAPRAADKPAGQAADPASSSADKPGASADAAARTPARARDAAAPDADTPPGGASLAA 403

                 ....
gi 297280195 464 PDTR 467
Cdd:PRK12372 404 AQAR 407
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
314-477 8.24e-07

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 51.33  E-value: 8.24e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  314 GPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPG--STGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPG 391
Cdd:PHA03307   45 SDSAELAAVTVVAGAAACDRFEPPTGPPPGPGTEAPANesRSTPTWSLSTLAPASPAREGSPTPPGPSSPDPPPPTPPPA 124
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  392 STGP-PARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPP--ARVVTSAPDTSAAPGSTGPParvvtsapdtrP 468
Cdd:PHA03307  125 SPPPsPAPDLSEMLRPVGSPGPPPAASPPAAGASPAAVASDAASSRqaALPLSSPEETARAPSSPPAE-----------P 193

                  ....*....
gi 297280195  469 PGSTAPPAH 477
Cdd:PHA03307  194 PPSTPPAAA 202
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
314-441 9.31e-07

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 51.14  E-value: 9.31e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 314 GPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGST 393
Cdd:PRK07764 384 RLGVAGGAGAPAAAAPSAAAAAPAAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPAPPSPAGNAPAGGAPSPPPAAAPS 463
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 297280195 394 GPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVT 441
Cdd:PRK07764 464 AQPAPAPAAAPEPTAAPAPAPPAAPAPAAAPAAPAAPAAPAGADDAAT 511
PHA03247 PHA03247
large tegument protein UL36; Provisional
302-545 1.06e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 51.09  E-value: 1.06e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  302 SAPDTSAAPGSTGPPARVVTSAPDtsAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVT 381
Cdd:PHA03247 2567 SVPPPRPAPRPSEPAVTSRARRPD--APPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHPPP 2644
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  382 SAP-----DTSAAPGSTGPP--ARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTG 454
Cdd:PHA03247 2645 TVPpperpRDDPAPGRVSRPrrARRLGRAAQASSPPQRPRRRAARPTVGSLTSLADPPPPPPTPEPAPHALVSATPLPPG 2724
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  455 PPARVVTSAPDTRPPGSTAPPAHDVTSASDSASGSASTlvhsttsaratTTPASKSTPFSIPShhSDTPTTLASHSTKTD 534
Cdd:PHA03247 2725 PAAARQASPALPAAPAPPAVPAGPATPGGPARPARPPT-----------TAGPPAPAPPAAPA--AGPPRRLTRPAVASL 2791
                         250
                  ....*....|.
gi 297280195  535 ASSTHHSTVPP 545
Cdd:PHA03247 2792 SESRESLPSPW 2802
PRK12372 PRK12372
ribonuclease III; Reviewed
307-475 1.69e-06

ribonuclease III; Reviewed


Pssm-ID: 237081 [Multi-domain]  Cd Length: 413  Bit Score: 49.90  E-value: 1.69e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 307 SAAPGSTGPPARVVTSAPDTSA----APGSTGPPARVVTSAPDT---SAAPGSTGPPARVVTSAPDTSAAPGSTGPPARV 379
Cdd:PRK12372 222 AAAPMLAAKPKRSKNARASKHVepeiVPGVKGVQEALDLRSPERkerAAAREARAAAAAPAATAAAAAPAEEPAVAPMAA 301
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 380 VTSA-PDTSAAPGStgppaRVVTSAPDTSAAPGSTGPPARVVTSA--PDTSAAPGSTGPPARVVTSAPDTSAAPG-STGP 455
Cdd:PRK12372 302 IRAAhVETAADKGE-----RAAKPAAADKAADKPADRPDAAEKAAekPAEAAPRAADKPAGQAADPASSSADKPGaSADA 376
                        170       180
                 ....*....|....*....|
gi 297280195 456 PARVVTSAPDTRPPGSTAPP 475
Cdd:PRK12372 377 AARTPARARDAAAPDADTPP 396
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
283-457 2.00e-06

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138 [Multi-domain]  Cd Length: 647  Bit Score: 49.86  E-value: 2.00e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 283 ALAMEPATGSAttlghnVTSAPDTSAAPGSTGPParvvTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTS 362
Cdd:PRK07994 356 MLAFHPAAPLP------EPEVPPQSAAPAASAQA----TAAPTAAVAPPQAPAVPPPPASAPQQAPAVPLPETTSQLLAA 425
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 363 APDTSAAPGSTGPParvVTSAPDTSAAPGSTGPPARV--VTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPArvV 440
Cdd:PRK07994 426 RQQLQRAQGATKAK---KSEPAAASRARPVNSALERLasVRPAPSALEKAPAKKEAYRWKATNPVEVKKEPVATPKA--L 500
                        170
                 ....*....|....*..
gi 297280195 441 TSAPDTSAAPGSTGPPA 457
Cdd:PRK07994 501 KKALEHEKTPELAAKLA 517
PHA03247 PHA03247
large tegument protein UL36; Provisional
302-475 2.12e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 50.32  E-value: 2.12e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  302 SAPDTSAAPGSTGPPARVVTSAPD-------TSAAPGSTGPPaRVVT-------SAPDTSAAPGSTGPPArVVTSAPDTS 367
Cdd:PHA03247 2490 FAAGAAPDPGGGGPPDPDAPPAPSrlapailPDEPVGEPVHP-RMLTwirgleeLASDDAGDPPPPLPPA-APPAAPDRS 2567
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  368 A-----APGSTGPPARVVTSAPDtsAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTS 442
Cdd:PHA03247 2568 VppprpAPRPSEPAVTSRARRPD--APPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPSPAANEPDPHPPPT 2645
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 297280195  443 AP-----DTSAAPGSTGPPARVVTSApdtRPPGSTAPP 475
Cdd:PHA03247 2646 VPpperpRDDPAPGRVSRPRRARRLG---RAAQASSPP 2680
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
316-480 3.15e-06

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138 [Multi-domain]  Cd Length: 647  Bit Score: 49.09  E-value: 3.15e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 316 PARVVtSAPDTSAAPgSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGP 395
Cdd:PRK07994 361 PAAPL-PEPEVPPQS-AAPAASAQATAAPTAAVAPPQAPAVPPPPASAPQQAPAVPLPETTSQLLAARQQLQRAQGATKA 438
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 396 ParvvtsapdtSAAPgSTGPPARVVTSAPDTSAAPGstgPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPP 475
Cdd:PRK07994 439 K----------KSEP-AAASRARPVNSALERLASVR---PAPSALEKAPAKKEAYRWKATNPVEVKKEPVATPKALKKAL 504

                 ....*
gi 297280195 476 AHDVT 480
Cdd:PRK07994 505 EHEKT 509
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
360-480 5.49e-06

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 48.44  E-value: 5.49e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 360 VTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGST-GPPARVVTSAPDTSAAPGSTGPPAR 438
Cdd:PRK07764 586 AVVGPAPGAAGGEGPPAPASSGPPEEAARPAAPAAPAAPAAPAPAGAAAAPAEAsAAPAPGVAAPEHHPKHVAVPDASDG 665
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 297280195 439 V-VTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPAHDVT 480
Cdd:PRK07764 666 GdGWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAAT 708
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
287-439 5.68e-06

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 48.44  E-value: 5.68e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 287 EPATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVvTSAPDTSAAPGSTGPPARVVTSAPDT 366
Cdd:PRK07764 655 KHVAVPDASDGGDGWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAPAPAA-TPPAGQADDPAAQPPQAAQGASAPSP 733
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 297280195 367 SAAPGSTGPPArvvTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDT-SAAPGSTGPPARV 439
Cdd:PRK07764 734 AADDPVPLPPE---PDDPPDPAGAPAQPPPPPAPAPAAAPAAAPPPSPPSEEEEMAEDDApSMDDEDRRDAEEV 804
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
302-476 5.72e-06

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 48.63  E-value: 5.72e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  302 SAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARvvtsapdtSAAPGSTGPPAR--- 378
Cdd:PHA03307  158 SPAAVASDAASSRQAALPLSSPEETARAPSSPPAEPPPSTPPAAASPRPPRRSSPIS--------ASASSPAPAPGRsaa 229
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  379 -------------------------VVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGST 433
Cdd:PHA03307  230 ddagasssdssssessgcgwgpeneCPLPRPAPITLPTRIWEASGWNGPSSRPGPASSSSSPRERSPSPSPSSPGSGPAP 309
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*....
gi 297280195  434 GPPARVVTSAPDTSAAPGSTGP------PARVVTSAPDTRPPGSTAPPA 476
Cdd:PHA03307  310 SSPRASSSSSSSRESSSSSTSSssessrGAAVSPGPSPSRSPSPSRPPP 358
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
288-410 5.88e-06

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 48.44  E-value: 5.88e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 288 PATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTS 367
Cdd:PRK07764 386 GVAGGAGAPAAAAPSAAAAAPAAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPAPPSPAGNAPAGGAPSPPPAAAPSAQ 465
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 297280195 368 AAPGSTGPPARVVTSAPDTSAAPGSTGPPArvVTSAPDTSAAP 410
Cdd:PRK07764 466 PAPAPAAAPEPTAAPAPAPPAAPAPAAAPA--APAAPAAPAGA 506
PHA03247 PHA03247
large tegument protein UL36; Provisional
335-558 6.06e-06

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 48.78  E-value: 6.06e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  335 PPARVVTSAPDTSAAPGSTGPPARVVTSAPDtsAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTG 414
Cdd:PHA03247 2560 PPAAPDRSVPPPRPAPRPSEPAVTSRARRPD--APPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPPSPSPAANE 2637
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  415 PPARVVTSAP-----DTSAAPGSTGPPARVVT-------SAPDTSAAPGSTGPPARVVTSAPDTRPPGST-APPAHDVTS 481
Cdd:PHA03247 2638 PDPHPPPTVPpperpRDDPAPGRVSRPRRARRlgraaqaSSPPQRPRRRAARPTVGSLTSLADPPPPPPTpEPAPHALVS 2717
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 297280195  482 ASDSASGSASTLVHSTTSARATTTPASKSTPfSIPShhsdTPTTLASHSTKTDASSTHHSTVPPFTSSNHSTSPQLS 558
Cdd:PHA03247 2718 ATPLPPGPAAARQASPALPAAPAPPAVPAGP-ATPG----GPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVA 2789
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
301-401 6.17e-06

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 48.35  E-value: 6.17e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  301 TSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPParvvtsAPDTSAAPGSTGPPArvvtsAPDTSAAPgstgPPARVV 380
Cdd:PRK12270   41 TAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPA------AAAPAAPPKPAAAAA-----AAAAPAAP----PAAAAA 105
                          90       100
                  ....*....|....*....|....
gi 297280195  381 TSAPDTSAAPGST---GPPARVVT 401
Cdd:PRK12270  106 AAPAAAAVEDEVTplrGAAAAVAK 129
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
321-421 6.17e-06

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 48.35  E-value: 6.17e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  321 TSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPParvvtsAPDTSAAPGSTGPPArvvtsAPDTSAAPgstgPPARVV 400
Cdd:PRK12270   41 TAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPA------AAAPAAPPKPAAAAA-----AAAAPAAP----PAAAAA 105
                          90       100
                  ....*....|....*....|....
gi 297280195  401 TSAPDTSAAPGST---GPPARVVT 421
Cdd:PRK12270  106 AAPAAAAVEDEVTplrGAAAAVAK 129
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
341-441 6.17e-06

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 48.35  E-value: 6.17e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  341 TSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPParvvtsAPDTSAAPGSTGPPArvvtsAPDTSAAPgstgPPARVV 420
Cdd:PRK12270   41 TAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPA------AAAPAAPPKPAAAAA-----AAAAPAAP----PAAAAA 105
                          90       100
                  ....*....|....*....|....
gi 297280195  421 TSAPDTSAAPGST---GPPARVVT 441
Cdd:PRK12270  106 AAPAAAAVEDEVTplrGAAAAVAK 129
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
361-461 6.17e-06

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 48.35  E-value: 6.17e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  361 TSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPParvvtsAPDTSAAPGSTGPPArvvtsAPDTSAAPgstgPPARVV 440
Cdd:PRK12270   41 TAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPA------AAAPAAPPKPAAAAA-----AAAAPAAP----PAAAAA 105
                          90       100
                  ....*....|....*....|....
gi 297280195  441 TSAPDTSAAPGST---GPPARVVT 461
Cdd:PRK12270  106 AAPAAAAVEDEVTplrGAAAAVAK 129
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
304-475 7.25e-06

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 48.24  E-value: 7.25e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  304 PDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPparvvTSA 383
Cdd:PHA03307  260 PAPITLPTRIWEASGWNGPSSRPGPASSSSSPRERSPSPSPSSPGSGPAPSSPRASSSSSSSRESSSSSTSS-----SSE 334
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  384 PDTSAAPGSTGPPARVVTSAPDT-SAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDT---SAAPGSTGPPARV 459
Cdd:PHA03307  335 SSRGAAVSPGPSPSRSPSPSRPPpPADPSSPRKRPRPSRAPSSPAASAGRPTRRRARAAVAGRArrrDATGRFPAGRPRP 414
                         170
                  ....*....|....*.
gi 297280195  460 VTSAPDTRPPGSTAPP 475
Cdd:PHA03307  415 SPLDAGAASGAFYARY 430
rne PRK10811
ribonuclease E; Reviewed
300-474 1.14e-05

ribonuclease E; Reviewed


Pssm-ID: 236766 [Multi-domain]  Cd Length: 1068  Bit Score: 47.73  E-value: 1.14e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  300 VTSAPDTSAAPgsTGPPARVVTSAPDTSAAPGSTGPParVVTSAPDTSAApgstgppARVVTSAPDTSAAPGSTGPParv 379
Cdd:PRK10811  864 VQVQPVVAEVP--VAAAVEPVVSAPVVEAVAEVVEEP--VVVAEPQPEEV-------VVVETTHPEVIAAPVTEQPQ--- 929
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  380 VTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARV 459
Cdd:PRK10811  930 VITESDVAVAQEVAEHAEPVVEPQDETADIEEAAETAEVVVAEPEVVAQPAAPVVAEVAAEVETVTAVEPEVAPAQVPEA 1009
                         170       180
                  ....*....|....*....|
gi 297280195  460 V-----TSAPDTRPPgstAP 474
Cdd:PRK10811 1010 TvehnhATAPMTRAP---AP 1026
rne PRK10811
ribonuclease E; Reviewed
275-459 1.42e-05

ribonuclease E; Reviewed


Pssm-ID: 236766 [Multi-domain]  Cd Length: 1068  Bit Score: 47.34  E-value: 1.42e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  275 TQGQDV-TLALAMEPATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPArVVTSAPDTSAAPGST 353
Cdd:PRK10811  848 VRPQDVqVEEQREAEEVQVQPVVAEVPVAAAVEPVVSAPVVEAVAEVVEEPVVVAEPQPEEVVV-VETTHPEVIAAPVTE 926
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  354 GPParvVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGST 433
Cdd:PRK10811  927 QPQ---VITESDVAVAQEVAEHAEPVVEPQDETADIEEAAETAEVVVAEPEVVAQPAAPVVAEVAAEVETVTAVEPEVAP 1003
                         170       180       190
                  ....*....|....*....|....*....|..
gi 297280195  434 GPPARVV-----TSAPDTSA-APGSTGPPARV 459
Cdd:PRK10811 1004 AQVPEATvehnhATAPMTRApAPEYVPEAPRH 1035
PHA03378 PHA03378
EBNA-3B; Provisional
287-476 1.60e-05

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 46.98  E-value: 1.60e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 287 EPATGSATTLGHNVTSAPDTSAAPGSTGPparvvTSAPDTSAAPGSTGPPARVVTsaPDTSAAPGSTG--PPArvvTSAP 364
Cdd:PHA03378 552 EPASTEPVHDQLLPAPGLGPLQIQPLTSP-----TTSQLASSAPSYAQTPWPVPH--PSQTPEPPTTQshIPE---TSAP 621
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 365 DTSAAPGSTGP--PARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTgpPARVVTSAPDT----SAAPGSTGPPAR 438
Cdd:PHA03378 622 RQWPMPLRPIPmrPLRMQPITFNVLVFPTPHQPPQVEITPYKPTWTQIGHI--PYQPSPTGANTmlpiQWAPGTMQPPPR 699
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 297280195 439 VVTSAPDTSAAPGSTGPPARVVTSA-PDTRPPGSTAPPA 476
Cdd:PHA03378 700 APTPMRPPAAPPGRAQRPAAATGRArPPAAAPGRARPPA 738
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
233-549 2.16e-05

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 46.69  E-value: 2.16e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  233 STPGGEKETSATQRSSMPISTKNAVSMTSRLSSHSPVSGSSTTQGQDVTLALAMEPATGSAT--TLGHNVTSAPDTSAAP 310
Cdd:pfam05109 451 TTPSLPPASTGPTVSTADPTSGTPTGTTSSTLPEDTSPTSRTTSATPNATSPTPAVTTPNATspTTQKTSDTPNATSPTP 530
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  311 GSTGPPArVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPArVVTSAPDTSAApGSTGPPARVVTSAPDTSAap 390
Cdd:pfam05109 531 IVIGVTT-TATSPPTGTTSVPNATSPQVTEESPVNNTNTPVVTSAPS-VLTSAVTTGQH-GTGSSPTSQQPGIPSSSH-- 605
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  391 gSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDT-SAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSApdTRPP 469
Cdd:pfam05109 606 -STPRSNSTSTTPLLTSAHPTGGENITEETPSVPSTtHVSTLSPGPGPGTTSQVSGPGNSSTSRYPGEVHVTEG--MPNP 682
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  470 GSTAPPA---HDVTSASDSASGSASTLVHSTTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHSTVPPF 546
Cdd:pfam05109 683 NATSPSApsgQKTAVPTVTSTGGKANSTTKETSGSTLMASTSPHTNEGAFRTTPYNATTYLPPSTSSKLRPRWTFTSPPV 762

                  ...
gi 297280195  547 TSS 549
Cdd:pfam05109 763 TTK 765
PHA03377 PHA03377
EBNA-3C; Provisional
306-450 2.72e-05

EBNA-3C; Provisional


Pssm-ID: 177614 [Multi-domain]  Cd Length: 1000  Bit Score: 46.20  E-value: 2.72e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  306 TSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPParVVTSAPD 385
Cdd:PHA03377  558 SDRGPPKASPPVMAPPSTGPRVMATPSTGPRDMAPPSTGPRQQAKCKDGPPASGPHEKQPPSSAPRDMAPS--VVRMFLR 635
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 297280195  386 TSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAP 450
Cdd:PHA03377  636 ERLLEQSTGPKPKSFWEMRAGRDGSGIQQEPSSRRQPATQSTPPRPSWLPSVFVLPSVDAGRAQP 700
PRK12372 PRK12372
ribonuclease III; Reviewed
308-451 3.32e-05

ribonuclease III; Reviewed


Pssm-ID: 237081 [Multi-domain]  Cd Length: 413  Bit Score: 45.66  E-value: 3.32e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 308 AAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSA-PDTSAAPGStgppaRVVTSAPDTSAAPGSTGPPARVVTSA--P 384
Cdd:PRK12372 270 AAREARAAAAAPAATAAAAAPAEEPAVAPMAAIRAAhVETAADKGE-----RAAKPAAADKAADKPADRPDAAEKAAekP 344
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 297280195 385 DTSAAPGSTGPPARVVTSAPDTSAAPG-STGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPG 451
Cdd:PRK12372 345 AEAAPRAADKPAGQAADPASSSADKPGaSADAAARTPARARDAAAPDADTPPGGASLAAAQARVADAD 412
PRK07764 PRK07764
DNA polymerase III subunits gamma and tau; Validated
280-523 3.35e-05

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236090 [Multi-domain]  Cd Length: 824  Bit Score: 46.13  E-value: 3.35e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 280 VTLALAMEPATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARV-----VTSAPDTSAAPGSTG 354
Cdd:PRK07764 385 LGVAGGAGAPAAAAPSAAAAAPAAAPAPAAAAPAAAAAPAPAAAPQPAPAPAPAPAPPSPagnapAGGAPSPPPAAAPSA 464
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 355 PPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPP-------------------------------ARV---- 399
Cdd:PRK07764 465 QPAPAPAAAPEPTAAPAPAPPAAPAPAAAPAAPAAPAAPAGAddaatlrerwpeilaavpkrsrktwaillpeATVlgvr 544
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 400 -----------------------------------------VTSAPDTSAAPGsTGPPARVVTSAPDTSAAPGSTGPPAR 438
Cdd:PRK07764 545 gdtlvlgfstgglarrfaspgnaevlvtalaeelggdwqveAVVGPAPGAAGG-EGPPAPASSGPPEEAARPAAPAAPAA 623
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 439 VVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPAHDVTSASDSASGSASTLVHSTTSARATTTPASKSTPFSIPSH 518
Cdd:PRK07764 624 PAAPAPAGAAAAPAEASAAPAPGVAAPEHHPKHVAVPDASDGGDGWPAKAGGAAPAAPPPAPAPAAPAAPAGAAPAQPAP 703

                 ....*
gi 297280195 519 HSDTP 523
Cdd:PRK07764 704 APAAT 708
UV_excision_repair_protein_RAD23_homolog_A TIGR00601
UV excision repair protein Rad23; All proteins in this family for which functions are known ...
306-476 4.12e-05

UV excision repair protein Rad23; All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273167 [Multi-domain]  Cd Length: 378  Bit Score: 45.27  E-value: 4.12e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  306 TSAAPGSTGPPARVVTSAPdtsaAPGSTGPPArvvtSAPDTSAAPGSTGPPArvvTSAPDTSAAPGSTGPPARVVTSAPD 385
Cdd:TIGR00601  77 PKTGTGKVAPPAATPTSAP----TPTPSPPAS----PASGMSAAPASAVEEK---SPSEESATATAPESPSTSVPSSGSD 145
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  386 TSA--APGSTGPPA--RVVTSAPDTS----AAPGSTGPPARVVTSApdTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPA 457
Cdd:TIGR00601 146 AAStlVVGSERETTieEIMEMGYEREeverALRAAFNNPDRAVEYL--LTGIPEDPEQPEPVQQTAASTAAATTETPQHG 223
                         170
                  ....*....|....*....
gi 297280195  458 RVVTSAPDTRPPGSTAPPA 476
Cdd:TIGR00601 224 SVFEQAAQGGTEQPATEAA 242
PTZ00436 PTZ00436
60S ribosomal protein L19-like protein; Provisional
345-480 4.88e-05

60S ribosomal protein L19-like protein; Provisional


Pssm-ID: 185616 [Multi-domain]  Cd Length: 357  Bit Score: 44.94  E-value: 4.88e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 345 DTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAP--GSTGPPARVVTS 422
Cdd:PTZ00436 191 EDAAAAAAAKQKAAAKKAAAPSGKKSAKAAAPAKAAAAPAKAAAPPAKAAAAPAKAAAAPAKAAAPpaKAAAPPAKAAAP 270
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 297280195 423 APDTSAAPG-STGPPARVVTSAPDTSAAPGST-GPPARVVTSAPDTR--PPGSTAPPAHDVT 480
Cdd:PTZ00436 271 PAKAAAPPAkAAAPPAKAAAPPAKAAAAPAKAaAAPAKAAAAPAKAAapPAKAAAPPAKAAT 332
PRK12727 PRK12727
flagellar biosynthesis regulator FlhF; Provisional
301-476 5.64e-05

flagellar biosynthesis regulator FlhF; Provisional


Pssm-ID: 237182 [Multi-domain]  Cd Length: 559  Bit Score: 44.98  E-value: 5.64e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 301 TSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPA------RVVTSAPDTSAA---------PGSTGPPARVVTSAPD 365
Cdd:PRK12727  57 TARSDTPATAAAPAPAPQAPTKPAAPVHAPLKLSANAnmsqrqRVASAAEDMIAAmalrqpvsvPRQAPAAAPVRAASIP 136
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 366 TSA----APGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPG-----STGPP 436
Cdd:PRK12727 137 SPAaqalAHAAAVRTAPRQEHALSAVPEQLFADFLTTAPVPRAPVQAPVVAAPAPVPAIAAALAAHAAYAqdddeQLDDD 216
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|
gi 297280195 437 ARVVTSAPDTSAAPGSTgPPARVVTSAPDTRPPGSTAPPA 476
Cdd:PRK12727 217 GFDLDDALPQILPPAAL-PPIVVAPAAPAALAAVAAAAPA 255
PHA03377 PHA03377
EBNA-3C; Provisional
329-555 5.86e-05

EBNA-3C; Provisional


Pssm-ID: 177614 [Multi-domain]  Cd Length: 1000  Bit Score: 45.43  E-value: 5.86e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  329 APGSTGPPArvvTSAPdtSAAPGSTGPPArvvtsapdtsAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSA 408
Cdd:PHA03377  556 SPSDRGPPK---ASPP--VMAPPSTGPRV----------MATPSTGPRDMAPPSTGPRQQAKCKDGPPASGPHEKQPPSS 620
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  409 APGSTGPParVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPAHDVTSASDSASG 488
Cdd:PHA03377  621 APRDMAPS--VVRMFLRERLLEQSTGPKPKSFWEMRAGRDGSGIQQEPSSRRQPATQSTPPRPSWLPSVFVLPSVDAGRA 698
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 297280195  489 SASTLVHSTTSARATTTPASKSTPFSIPshhsDTPTTLASHSTkTDASSTHHSTVPPFTSSNHSTSP 555
Cdd:PHA03377  699 QPSEESHLSSMSPTQPISHEEQPRYEDP----DDPLDLSLHPD-QAPPPSHQAPYSGHEEPQAQQAP 760
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
306-458 7.31e-05

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 45.06  E-value: 7.31e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  306 TSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGS---TGPPARVVTSAPDTSAAPGSTGPPARVVTS 382
Cdd:pfam03154 395 THHPPSAHPPPLQLMPQSQPLQSVPAQPPVLTQSQSLPPKASTHPHSglhSGPPQSPFAQHPFTSGGLPAIGPPPSLPTS 474
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 297280195  383 APDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPAR 458
Cdd:pfam03154 475 TPAAPPRASSGSQPPGSALPSSGGCAGPGPPLPPIQIKEEPLDEAEEPESPPPPPRSPSPEPTVVNTPSHASQSAR 550
PHA03378 PHA03378
EBNA-3B; Provisional
301-476 7.67e-05

EBNA-3B; Provisional


Pssm-ID: 223065 [Multi-domain]  Cd Length: 991  Bit Score: 45.06  E-value: 7.67e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 301 TSAPDTSAAPGSTGPPARVVTsaPDTSAAPGSTG--PPArvvTSAPDTSAAPGSTGP--PARVVTSAPDTSAAPGSTGPP 376
Cdd:PHA03378 581 TTSQLASSAPSYAQTPWPVPH--PSQTPEPPTTQshIPE---TSAPRQWPMPLRPIPmrPLRMQPITFNVLVFPTPHQPP 655
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 377 ARVVTSAPDTSAAPGSTgpPARVVTSAPDT----SAAPGSTGPPARvvtsapdtsaAPGSTGPPARVVTSAPDTSAAPGS 452
Cdd:PHA03378 656 QVEITPYKPTWTQIGHI--PYQPSPTGANTmlpiQWAPGTMQPPPR----------APTPMRPPAAPPGRAQRPAAATGR 723
                        170       180
                 ....*....|....*....|....*
gi 297280195 453 TGPPARVVTSA-PDTRPPGSTAPPA 476
Cdd:PHA03378 724 ARPPAAAPGRArPPAAAPGRARPPA 748
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
198-473 8.11e-05

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 44.77  E-value: 8.11e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  198 PTQSTTTMTPGTQSPffLLLILTVLTVVTGSGHTNSTPGGEKETSATQrSSMPISTKNAVSMTSRLSSHSPVSGSSTTQG 277
Cdd:pfam05109 488 PTSRTTSATPNATSP--TPAVTTPNATSPTTQKTSDTPNATSPTPIVI-GVTTTATSPPTGTTSVPNATSPQVTEESPVN 564
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  278 QDVTLALAMEP--ATGSATTLGHNVTSAPDT--SAAPGSTGPPARV---VTSAPDTSAAPGSTGPPARVVTSAPDT-SAA 349
Cdd:pfam05109 565 NTNTPVVTSAPsvLTSAVTTGQHGTGSSPTSqqPGIPSSSHSTPRSnstSTTPLLTSAHPTGGENITEETPSVPSTtHVS 644
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  350 PGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTsaapgSTGPPARVVTSAPDTSAA 429
Cdd:pfam05109 645 TLSPGPGPGTTSQVSGPGNSSTSRYPGEVHVTEGMPNPNATSPSAPSGQKTAVPTVT-----STGGKANSTTKETSGSTL 719
                         250       260       270       280
                  ....*....|....*....|....*....|....*....|....*..
gi 297280195  430 PGSTGPPARVVTSAPdTSAAPGSTGPPARVVTSAP---DTRPPGSTA 473
Cdd:pfam05109 720 MASTSPHTNEGAFRT-TPYNATTYLPPSTSSKLRPrwtFTSPPVTTK 765
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
288-411 8.51e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 44.71  E-value: 8.51e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 288 PATGSATTLGhnVTSAPDTSAAPGSTGPPArVVTSAPdtsAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTS 367
Cdd:PRK14951 381 PARPEAAAPA--AAPVAQAAAAPAPAAAPA-AAASAP---AAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAPAPPAQ 454
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....
gi 297280195 368 AAPGSTGPPARVVTSAPDTSAAPGSTGPPArvvtSAPDTSAAPG 411
Cdd:PRK14951 455 AAPETVAIPVRVAPEPAVASAAPAPAAAPA----AARLTPTEEG 494
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
315-464 8.66e-05

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 44.68  E-value: 8.66e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  315 PPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGS---TGPPARVVTSAPDTSAAPG 391
Cdd:pfam03154 384 PPALKPLSSLPTHHPPSAHPPPLQLMPQSQPLQSVPAQPPVLTQSQSLPPKASTHPHSglhSGPPQSPFAQHPFTSGGLP 463
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 297280195  392 STGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAP 464
Cdd:pfam03154 464 AIGPPPSLPTSTPAAPPRASSGSQPPGSALPSSGGCAGPGPPLPPIQIKEEPLDEAEEPESPPPPPRSPSPEP 536
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
401-475 8.74e-05

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 44.88  E-value: 8.74e-05
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 297280195  401 TSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPP 475
Cdd:PRK12270   41 TAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAAAAVED 115
PRK14959 PRK14959
DNA polymerase III subunits gamma and tau; Provisional
282-432 8.89e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 184923 [Multi-domain]  Cd Length: 624  Bit Score: 44.67  E-value: 8.89e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 282 LALAMEPATGSATTL--GHNVTSAPDTSAAPGstgPPARVVTSAPdtsaAPGSTGPPARV-VTSAPDTSAAPGSTGPPAR 358
Cdd:PRK14959 357 LNLAMLPRLMPVESLrpSGGGASAPSGSAAEG---PASGGAATIP----TPGTQGPQGTApAAGMTPSSAAPATPAPSAA 429
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 297280195 359 VVTSAP--DTSAAPGSTGPPARVVTSAPDTSAAPGStgpPARVVTSApdtsAAPGSTGPPArvvTSAPDTSAAPGS 432
Cdd:PRK14959 430 PSPRVPwdDAPPAPPRSGIPPRPAPRMPEASPVPGA---PDSVASAS----DAPPTLGDPS---DTAEHTPSGPRT 495
PRK14959 PRK14959
DNA polymerase III subunits gamma and tau; Provisional
362-474 9.12e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 184923 [Multi-domain]  Cd Length: 624  Bit Score: 44.67  E-value: 9.12e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 362 SAPDTSAAPGstgPPARVVTSAPdtsaAPGSTGPPARV-VTSAPDTSAAPGSTGPPARVVTSAP--DTSAAPGSTGPPAR 438
Cdd:PRK14959 379 SAPSGSAAEG---PASGGAATIP----TPGTQGPQGTApAAGMTPSSAAPATPAPSAAPSPRVPwdDAPPAPPRSGIPPR 451
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 297280195 439 VVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAP 474
Cdd:PRK14959 452 PAPRMPEASPVPGAPDSVASASDAPPTLGDPSDTAE 487
PRK07994 PRK07994
DNA polymerase III subunits gamma and tau; Validated
281-437 1.04e-04

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236138 [Multi-domain]  Cd Length: 647  Bit Score: 44.47  E-value: 1.04e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 281 TLALAMEPATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPParvV 360
Cdd:PRK07994 364 PLPEPEVPPQSAAPAASAQATAAPTAAVAPPQAPAVPPPPASAPQQAPAVPLPETTSQLLAARQQLQRAQGATKAK---K 440
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 297280195 361 TSAPDTSAAPGSTGPPARV--VTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPArvVTSAPDTSAAPGSTGPPA 437
Cdd:PRK07994 441 SEPAAASRARPVNSALERLasVRPAPSALEKAPAKKEAYRWKATNPVEVKKEPVATPKA--LKKALEHEKTPELAAKLA 517
PRK12372 PRK12372
ribonuclease III; Reviewed
285-431 1.08e-04

ribonuclease III; Reviewed


Pssm-ID: 237081 [Multi-domain]  Cd Length: 413  Bit Score: 44.12  E-value: 1.08e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 285 AMEPATGSATTLghnVTSAPDTSAAPGSTGPPARVVTSA-PDTSAAPGStgppaRVVTSAPDTSAAPGSTGPPARVVTSA 363
Cdd:PRK12372 270 AAREARAAAAAP---AATAAAAAPAEEPAVAPMAAIRAAhVETAADKGE-----RAAKPAAADKAADKPADRPDAAEKAA 341
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 297280195 364 --PDTSAAPGSTGPPARVVTSAPDTSAAPG-STGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPG 431
Cdd:PRK12372 342 ekPAEAAPRAADKPAGQAADPASSSADKPGaSADAAARTPARARDAAAPDADTPPGGASLAAAQARVADAD 412
PHA03325 PHA03325
nuclear-egress-membrane-like protein; Provisional
311-477 1.36e-04

nuclear-egress-membrane-like protein; Provisional


Pssm-ID: 223044 [Multi-domain]  Cd Length: 418  Bit Score: 43.72  E-value: 1.36e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 311 GSTGPPARVVTSAPDTSAA---PGSTGPPARVVTSAPDTSAAPGStgpPARVVTSAPDTSAAPgstgPPARVVTSAPDts 387
Cdd:PHA03325 255 GQLTSSAFMLNSSLPTSAPkrrSRRAGAMRAAAGETADLADDDGS---EHSDPEPLPASLPPP----PVRRPRVKHPE-- 325
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 388 aAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTR 467
Cdd:PHA03325 326 -AGKEEPDGARNAEAKEPAQPATSTSSKGSSSAQNKDSGSTGPGSSLAAASSFLEDDDFGSPPLDLTTSLRHMPSPSVTS 404
                        170
                 ....*....|
gi 297280195 468 PPGSTAPPAH 477
Cdd:PHA03325 405 APEPPSIPLT 414
PHA03307 PHA03307
transcriptional regulator ICP4; Provisional
279-464 1.42e-04

transcriptional regulator ICP4; Provisional


Pssm-ID: 223039 [Multi-domain]  Cd Length: 1352  Bit Score: 44.01  E-value: 1.42e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  279 DVTLALAMEPATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTgpPARVVTSAPDTSAAPGSTGPPAR 358
Cdd:PHA03307  752 DITDALFSNPSLVPAKLAEALALLEPAEPQRGAGSSPPVRAEAAFRRPGRLRRSG--PAADAASRTASKRKSRSHTPDGG 829
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  359 VVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPG--STGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPP 436
Cdd:PHA03307  830 SESSGPARPPGAAARPPPARSSESSKSKPAAAGgrARGKNGRRRPRPPEPRARPGAAAPPKAAAAAPPAGAPAPRPRPAP 909
                         170       180       190
                  ....*....|....*....|....*....|.
gi 297280195  437 ARVVTSAPDTSAAPGSTG---PPARVVTSAP 464
Cdd:PHA03307  910 RVKLGPMPPGGPDPRGGFrrvPPGDLHTPAP 940
PTZ00436 PTZ00436
60S ribosomal protein L19-like protein; Provisional
283-410 1.63e-04

60S ribosomal protein L19-like protein; Provisional


Pssm-ID: 185616 [Multi-domain]  Cd Length: 357  Bit Score: 43.40  E-value: 1.63e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 283 ALAMEPATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPG-STGPPARVVTSAPDTSAAPG-STGPPARVV 360
Cdd:PTZ00436 217 AKAAAPAKAAAAPAKAAAPPAKAAAAPAKAAAAPAKAAAPPAKAAAPPAkAAAPPAKAAAPPAKAAAPPAkAAAPPAKAA 296
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 297280195 361 TSAPDTSAAPG--------STGPPARvvTSAPDTSAAPgstgPPARVVTSAPDTSAAP 410
Cdd:PTZ00436 297 AAPAKAAAAPAkaaaapakAAAPPAK--AAAPPAKAAT----PPAKAAAPPAKAAAAP 348
PRK12372 PRK12372
ribonuclease III; Reviewed
303-449 1.69e-04

ribonuclease III; Reviewed


Pssm-ID: 237081 [Multi-domain]  Cd Length: 413  Bit Score: 43.35  E-value: 1.69e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 303 APDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSA--PDTSAAPGSTGPPARVVTSAPDTSAAPGSTgpparvv 380
Cdd:PRK12372 271 AREARAAAAAPAATAAAAAPAEEPAVAPMAAIRAAHVETAAdkGERAAKPAAADKAADKPADRPDAAEKAAEK------- 343
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 297280195 381 tsaPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAA 449
Cdd:PRK12372 344 ---PAEAAPRAADKPAGQAADPASSSADKPGASADAAARTPARARDAAAPDADTPPGGASLAAAQARVA 409
PRK14971 PRK14971
DNA polymerase III subunits gamma and tau; Provisional
299-435 1.79e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237874 [Multi-domain]  Cd Length: 614  Bit Score: 43.61  E-value: 1.79e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 299 NVTSAPDTsaAPGSTGPPArvvtsapdtSAAPGSTGP-PARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAApgsTGPPA 377
Cdd:PRK14971 361 QLTQKGDD--ASGGRGPKQ---------HIKPVFTQPaAAPQPSAAAAASPSPSQSSAAAQPSAPQSATQPA---GTPPT 426
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 297280195 378 RVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAP----GSTGP----PARVVTSAPDTSAAPGSTGP 435
Cdd:PRK14971 427 VSVDPPAAVPVNPPSTAPQAVRPAQFKEEKKIPvskvSSLGPstlrPIQEKAEQATGNIKEAPTGT 492
motB PRK12799
flagellar motor protein MotB; Reviewed
320-437 2.01e-04

flagellar motor protein MotB; Reviewed


Pssm-ID: 183756 [Multi-domain]  Cd Length: 421  Bit Score: 43.17  E-value: 2.01e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 320 VTSAPDTSAAPGSTGPParvvtsaPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTS---APDTSAAPgSTGPP 396
Cdd:PRK12799 301 VAAVTPSSAVTQSSAIT-------PSSAAIPSPAVIPSSVTTQSATTTQASAVALSSAGVLPSdvtLPGTVALP-AAEPV 372
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 297280195 397 ARVVTSAPDTSAAPGSTGPPARvVTSAPDTS--AAPGSTGPPA 437
Cdd:PRK12799 373 NMQPQPMSTTETQQSSTGNITS-TANGPTTSlpAAPASNIPVS 414
motB PRK12799
flagellar motor protein MotB; Reviewed
340-457 2.01e-04

flagellar motor protein MotB; Reviewed


Pssm-ID: 183756 [Multi-domain]  Cd Length: 421  Bit Score: 43.17  E-value: 2.01e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 340 VTSAPDTSAAPGSTGPParvvtsaPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTS---APDTSAAPgSTGPP 416
Cdd:PRK12799 301 VAAVTPSSAVTQSSAIT-------PSSAAIPSPAVIPSSVTTQSATTTQASAVALSSAGVLPSdvtLPGTVALP-AAEPV 372
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 297280195 417 ARVVTSAPDTSAAPGSTGPPARvVTSAPDTS--AAPGSTGPPA 457
Cdd:PRK12799 373 NMQPQPMSTTETQQSSTGNITS-TANGPTTSlpAAPASNIPVS 414
motB PRK12799
flagellar motor protein MotB; Reviewed
300-417 2.01e-04

flagellar motor protein MotB; Reviewed


Pssm-ID: 183756 [Multi-domain]  Cd Length: 421  Bit Score: 43.17  E-value: 2.01e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 300 VTSAPDTSAAPGSTGPParvvtsaPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTS---APDTSAAPgSTGPP 376
Cdd:PRK12799 301 VAAVTPSSAVTQSSAIT-------PSSAAIPSPAVIPSSVTTQSATTTQASAVALSSAGVLPSdvtLPGTVALP-AAEPV 372
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|...
gi 297280195 377 ARVVTSAPDTSAAPGSTGPPARvVTSAPDTS--AAPGSTGPPA 417
Cdd:PRK12799 373 NMQPQPMSTTETQQSSTGNITS-TANGPTTSlpAAPASNIPVS 414
uvrC PRK14666
excinuclease ABC subunit C; Provisional
350-477 2.07e-04

excinuclease ABC subunit C; Provisional


Pssm-ID: 237782 [Multi-domain]  Cd Length: 694  Bit Score: 43.34  E-value: 2.07e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 350 PGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAP-DTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSA 428
Cdd:PRK14666 303 PQSTIPPRIVVPWLPDTEGREGDDLAPTAVCTDAGlLPDTPLLPDAPEGSSDPVVPVAAATPVDASLPDVRTGTAPTSLA 382
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|
gi 297280195 429 APGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTRP-PGSTAPPAH 477
Cdd:PRK14666 383 NVSHADPAVAQPTQAATLAGAAPKGATHLMLEETLADLRGgPVRIVPPRN 432
uvrC PRK14666
excinuclease ABC subunit C; Provisional
310-427 2.25e-04

excinuclease ABC subunit C; Provisional


Pssm-ID: 237782 [Multi-domain]  Cd Length: 694  Bit Score: 43.34  E-value: 2.25e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 310 PGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPdtsaapgsTGPPARVVTSAPDTSAAPGS-TGPPARVVTSAPDTSA 388
Cdd:PRK14666 303 PQSTIPPRIVVPWLPDTEGREGDDLAPTAVCTDAG--------LLPDTPLLPDAPEGSSDPVVpVAAATPVDASLPDVRT 374
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 297280195 389 APGSTGPparvvTSAPDTSAAPGSTGPPARVVTSAPDTS 427
Cdd:PRK14666 375 GTAPTSL-----ANVSHADPAVAQPTQAATLAGAAPKGA 408
uvrC PRK14666
excinuclease ABC subunit C; Provisional
330-447 2.25e-04

excinuclease ABC subunit C; Provisional


Pssm-ID: 237782 [Multi-domain]  Cd Length: 694  Bit Score: 43.34  E-value: 2.25e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 330 PGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPdtsaapgsTGPPARVVTSAPDTSAAPGS-TGPPARVVTSAPDTSA 408
Cdd:PRK14666 303 PQSTIPPRIVVPWLPDTEGREGDDLAPTAVCTDAG--------LLPDTPLLPDAPEGSSDPVVpVAAATPVDASLPDVRT 374
                         90       100       110
                 ....*....|....*....|....*....|....*....
gi 297280195 409 APGSTGPparvvTSAPDTSAAPGSTGPPARVVTSAPDTS 447
Cdd:PRK14666 375 GTAPTSL-----ANVSHADPAVAQPTQAATLAGAAPKGA 408
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
198-559 2.56e-04

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 43.23  E-value: 2.56e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  198 PTQSTTTMTPGTQSPFFLLLILTVLTVVTGSGHTNSTPGGEKETSATQRSSMPisTKNAVSMTSrLSSHSPVSGSSTTQG 277
Cdd:pfam05109 443 PHKTTAVPTTPSLPPASTGPTVSTADPTSGTPTGTTSSTLPEDTSPTSRTTSA--TPNATSPTP-AVTTPNATSPTTQKT 519
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  278 QDVTLALAMEPATGSATTlghNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPArVVTSAPDTSAApGSTGPPA 357
Cdd:pfam05109 520 SDTPNATSPTPIVIGVTT---TATSPPTGTTSVPNATSPQVTEESPVNNTNTPVVTSAPS-VLTSAVTTGQH-GTGSSPT 594
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  358 RVVTSAPDTSAapgSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDT-SAAPGSTGPPARVVTSAPDTSAAPGSTGPP 436
Cdd:pfam05109 595 SQQPGIPSSSH---STPRSNSTSTTPLLTSAHPTGGENITEETPSVPSTtHVSTLSPGPGPGTTSQVSGPGNSSTSRYPG 671
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  437 ARVVTSAPDTSAAPGSTGPparvvTSAPDTRPPGSTAPPAHDVTSASDSASGSASTLVHSTTSARATTTPASKSTPFSIP 516
Cdd:pfam05109 672 EVHVTEGMPNPNATSPSAP-----SGQKTAVPTVTSTGGKANSTTKETSGSTLMASTSPHTNEGAFRTTPYNATTYLPPS 746
                         330       340       350       360
                  ....*....|....*....|....*....|....*....|...
gi 297280195  517 SHHSDTPTTLASHSTKTDASSTHHstVPPFTSSNHSTSPQLSL 559
Cdd:pfam05109 747 TSSKLRPRWTFTSPPVTTKQATVP--VPPTQHPDHSNLSMLVL 787
PRK14971 PRK14971
DNA polymerase III subunits gamma and tau; Provisional
331-455 2.63e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237874 [Multi-domain]  Cd Length: 614  Bit Score: 42.84  E-value: 2.63e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 331 GSTGPPARvvtsAPDTSAAPGSTGP-PARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAApgsTGPPARVVTSAPDTSAA 409
Cdd:PRK14971 366 GDDASGGR----GPKQHIKPVFTQPaAAPQPSAAAAASPSPSQSSAAAQPSAPQSATQPA---GTPPTVSVDPPAAVPVN 438
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....
gi 297280195 410 PGSTGPPARVVTSAPDTSAAP----GSTGP----PARVVTSAPDTSAAPGSTGP 455
Cdd:PRK14971 439 PPSTAPQAVRPAQFKEEKKIPvskvSSLGPstlrPIQEKAEQATGNIKEAPTGT 492
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
405-476 2.90e-04

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 42.96  E-value: 2.90e-04
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 297280195  405 DTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPA 476
Cdd:PRK12270   38 PGSTAAPTAAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPA 109
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
286-381 3.21e-04

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 42.96  E-value: 3.21e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  286 MEPATGSATTlghnvTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPD 365
Cdd:PRK12270   36 YGPGSTAAPT-----AAAAAAAAAASAPAAAPAAKAPAAPAPAPPAAAAPAAPPKPAAAAAAAAAPAAPPAAAAAAAPAA 110
                          90
                  ....*....|....*....
gi 297280195  366 TSAAPGST---GPPARVVT 381
Cdd:PRK12270  111 AAVEDEVTplrGAAAAVAK 129
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
276-418 3.97e-04

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 42.75  E-value: 3.97e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  276 QGQDVTLALAMEPATGSATTLGHNVTSAPDTSAapgSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGP 355
Cdd:pfam03154 411 QSQPLQSVPAQPPVLTQSQSLPPKASTHPHSGL---HSGPPQSPFAQHPFTSGGLPAIGPPPSLPTSTPAAPPRASSGSQ 487
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 297280195  356 PARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPAR 418
Cdd:pfam03154 488 PPGSALPSSGGCAGPGPPLPPIQIKEEPLDEAEEPESPPPPPRSPSPEPTVVNTPSHASQSAR 550
PTZ00436 PTZ00436
60S ribosomal protein L19-like protein; Provisional
285-399 4.60e-04

60S ribosomal protein L19-like protein; Provisional


Pssm-ID: 185616 [Multi-domain]  Cd Length: 357  Bit Score: 41.86  E-value: 4.60e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 285 AMEPATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPG-STGPPARVVTSAPDTSAapgstgPPARVVTSA 363
Cdd:PTZ00436 240 AAAPAKAAAAPAKAAAPPAKAAAPPAKAAAPPAKAAAPPAKAAAPPAkAAAPPAKAAAAPAKAAA------APAKAAAAP 313
                         90       100       110
                 ....*....|....*....|....*....|....*.
gi 297280195 364 PDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARV 399
Cdd:PTZ00436 314 AKAAAPPAKAAAPPAKAATPPAKAAAPPAKAAAAPV 349
PRK12727 PRK12727
flagellar biosynthesis regulator FlhF; Provisional
279-455 5.12e-04

flagellar biosynthesis regulator FlhF; Provisional


Pssm-ID: 237182 [Multi-domain]  Cd Length: 559  Bit Score: 41.90  E-value: 5.12e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 279 DVTLALAMEPATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAA---------PGSTGPPARVVTSAPDTSA- 348
Cdd:PRK12727  61 DTPATAAAPAPAPQAPTKPAAPVHAPLKLSANANMSQRQRVASAAEDMIAAmalrqpvsvPRQAPAAAPVRAASIPSPAa 140
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 349 ---APGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPG-----STGPPARVV 420
Cdd:PRK12727 141 qalAHAAAVRTAPRQEHALSAVPEQLFADFLTTAPVPRAPVQAPVVAAPAPVPAIAAALAAHAAYAqdddeQLDDDGFDL 220
                        170       180       190
                 ....*....|....*....|....*....|....*
gi 297280195 421 TSAPDTSAAPGSTgPPARVVTSAPDTSAAPGSTGP 455
Cdd:PRK12727 221 DDALPQILPPAAL-PPIVVAPAAPAALAAVAAAAP 254
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
383-476 5.28e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 42.10  E-value: 5.28e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 383 APDTSAAPGSTGPPAR-VVTSAPDTSAAPgSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVT 461
Cdd:PRK14950 361 VPVPAPQPAKPTAAAPsPVRPTPAPSTRP-KAAAAANIPPKEPVRETATPPPVPPRPVAPPVPHTPESAPKLTRAAIPVD 439
                         90
                 ....*....|....*
gi 297280195 462 SAPDTRPPgstAPPA 476
Cdd:PRK14950 440 EKPKYTPP---APPK 451
kgd PRK12270
alpha-ketoglutarate decarboxylase; Reviewed
394-476 6.17e-04

alpha-ketoglutarate decarboxylase; Reviewed


Pssm-ID: 237030 [Multi-domain]  Cd Length: 1228  Bit Score: 42.18  E-value: 6.17e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  394 GPPARVVTSAPDTSAAPGSTGPPArvvtSAPDTSAAPGSTGPPArvvtsAPDTSAAPGSTGPPARVVTSAPDTRPPGSTA 473
Cdd:PRK12270   37 GPGSTAAPTAAAAAAAAAASAPAA----APAAKAPAAPAPAPPA-----AAAPAAPPKPAAAAAAAAAPAAPPAAAAAAA 107

                  ...
gi 297280195  474 PPA 476
Cdd:PRK12270  108 PAA 110
UV_excision_repair_protein_RAD23_homolog_A TIGR00601
UV excision repair protein Rad23; All proteins in this family for which functions are known ...
278-465 6.33e-04

UV excision repair protein Rad23; All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273167 [Multi-domain]  Cd Length: 378  Bit Score: 41.42  E-value: 6.33e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  278 QDVTLALAMEPATGSATTlgHNVTSAPDTSAAPGSTGPPArvvtSAPDTSAAPGSTGPPArvvTSAPDTSAAPGSTGPPA 357
Cdd:TIGR00601  67 KDFVVVMVSKPKTGTGKV--APPAATPTSAPTPTPSPPAS----PASGMSAAPASAVEEK---SPSEESATATAPESPST 137
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  358 RVVTSAPDTSA--APGSTGPPA--RVVTSAPDTS----AAPGSTGPPARVVTSApdTSAAPGSTGPPARVVTSAPDTSAA 429
Cdd:TIGR00601 138 SVPSSGSDAAStlVVGSERETTieEIMEMGYEREeverALRAAFNNPDRAVEYL--LTGIPEDPEQPEPVQQTAASTAAA 215
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 297280195  430 PGSTGPPARVVTSAP---DTSAAPGST--GPPARVVTSAPD 465
Cdd:TIGR00601 216 TTETPQHGSVFEQAAqggTEQPATEAAqgGNPLEFLRNQPQ 256
PLN02217 PLN02217
probable pectinesterase/pectinesterase inhibitor
371-475 7.47e-04

probable pectinesterase/pectinesterase inhibitor


Pssm-ID: 215130 [Multi-domain]  Cd Length: 670  Bit Score: 41.61  E-value: 7.47e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 371 GSTGPPARVVTSAPDT-SAAPGSTgpparvvTSAPDTSAAPGSTgppaRVVTSAPDTSAAPgSTGPPARVVTSAPDTSA- 448
Cdd:PLN02217 546 GDAWIPGKGVPYIPGLfAGNPGST-------NSTPTGSAASSNT----TFSSDSPSTVVAP-STSPPAGHLGSPPATPSk 613
                         90       100
                 ....*....|....*....|....*...
gi 297280195 449 -APGSTGPPARVVTSAPDTrpPGSTAPP 475
Cdd:PLN02217 614 iVSPSTSPPASHLGSPSTT--PSSPESS 639
Herpes_BLLF1 pfam05109
Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 ...
284-554 7.83e-04

Herpes virus major outer envelope glycoprotein (BLLF1); This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralizing antibodies in vivo.


Pssm-ID: 253014 [Multi-domain]  Cd Length: 830  Bit Score: 41.69  E-value: 7.83e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  284 LAMEPATGSATTLGHNVTsapdTSAAPGSTGPPARVVTSApdtSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSA 363
Cdd:pfam05109 404 LIITRTATNATTTTHKVV----FHKAPDTTKSVIFVYTLV---HVEPHKTTAVPTTPSLPPASTGPTVSTADPTSGTPTG 476
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  364 PDTSAAPGSTGPPARVVTSAPDTSAapgstgpPARVVTSAPDTSAAPGSTGPparvvtSAPDTSAAPGSTGPPARVVTSA 443
Cdd:pfam05109 477 TTSSTLPEDTSPTSRTTSATPNATS-------PTPAVTTPNATSPTTQKTSD------TPNATSPTPIVIGVTTTATSPP 543
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  444 PDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPAHDVTSASDSAsgsastlvHSTTSARATTTPASKSTPFSIPShHSDTP 523
Cdd:pfam05109 544 TGTTSVPNATSPQVTEESPVNNTNTPVVTSAPSVLTSAVTTGQ--------HGTGSSPTSQQPGIPSSSHSTPR-SNSTS 614
                         250       260       270
                  ....*....|....*....|....*....|.
gi 297280195  524 TTLASHSTKTDASSTHHSTVPPFTSSNHSTS 554
Cdd:pfam05109 615 TTPLLTSAHPTGGENITEETPSVPSTTHVST 645
PLN03209 PLN03209
translocon at the inner envelope of chloroplast subunit 62; Provisional
304-559 8.03e-04

translocon at the inner envelope of chloroplast subunit 62; Provisional


Pssm-ID: 178748 [Multi-domain]  Cd Length: 576  Bit Score: 41.45  E-value: 8.03e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 304 PDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPdTSAAPGSTGPPARVVTSA 383
Cdd:PLN03209 331 KESDAADGPKPVPTKPVTPEAPSPPIEEEPPQPKAVVPRPLSPYTAYEDLKPPTSPIPTPP-SSSPASSKSVDAVAKPAE 409
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 384 PDTSAAPGST-GPPARVVTSAPDTSAAPGStgPPARVVTSAPDTSAAPgstGPPARVVTSAPDTSAAPGSTGpparvvtS 462
Cdd:PLN03209 410 PDVVPSPGSAsNVPEVEPAQVEAKKTRPLS--PYARYEDLKPPTSPSP---TAPTGVSPSVSSTSSVPAVPD-------T 477
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 463 APDTRPPGSTAPPAHDVTSASDSASGSASTLVHSTTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHST 542
Cdd:PLN03209 478 APATAATDAAAPPPANMRPLSPYAVYDDLKPPTSPSPAAPVGKVAPSSTNEVVKVGNSAPPTALADEQHHAQPKPRPLSP 557
                        250
                 ....*....|....*..
gi 297280195 543 VPPFTSSNHSTSPQLSL 559
Cdd:PLN03209 558 YTMYEDLKPPTSPTPSP 574
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
383-478 8.38e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 41.24  E-value: 8.38e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 383 APDTSAA------------PGSTGPPArvvTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAP 450
Cdd:PRK14951 347 APDEYAAltmvllrllafkPAAAAEAA---APAEKKTPARPEAAAPAAAPVAQAAAAPAPAAAPAAAASAPAAPPAAAPP 423
                         90       100
                 ....*....|....*....|....*...
gi 297280195 451 GSTGPPARVVTSAPDTRPPGSTAPPAHD 478
Cdd:PRK14951 424 APVAAPAAAAPAAAPAAAPAAVALAPAP 451
PTZ00395 PTZ00395
Sec24-related protein; Provisional
291-475 8.51e-04

Sec24-related protein; Provisional


Pssm-ID: 185594 [Multi-domain]  Cd Length: 1560  Bit Score: 41.60  E-value: 8.51e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  291 GSATTLGHNVTSAPDTSAAPGStGPPAR-VVTSAPDTSAAPGSTGPPARVVTSAPDTSaaPGSTGPParvvTSAPDTSAA 369
Cdd:PTZ00395  360 GNQADGGHINQVHPDARGAWAG-GPHSNaSYNCAAYSNAAQSNAAQSNAGFSNAGYSN--PGNSNPG----YNNAPNSNT 432
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  370 PGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTG---PPARVVTSAPDTSAAPGSTGPPARVVTSAPDT 446
Cdd:PTZ00395  433 PYNNPPNSNTPYSNPPNSNPPYSNLPYSNTPYSNAPLSNAPPSSAkdhHSAYHAAYQHRAANQPAANLPTANQPAANNFH 512
                         170       180       190
                  ....*....|....*....|....*....|.
gi 297280195  447 SAAPGSTGPP--ARVVTSAPDTRPPGSTAPP 475
Cdd:PTZ00395  513 GAAGNSVGNPfaSRPFGSAPYGGNAATTADP 543
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
343-445 9.54e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 41.33  E-value: 9.54e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 343 APDTSAAPGSTGPPAR-VVTSAPDTSAAPgsTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVT 421
Cdd:PRK14950 361 VPVPAPQPAKPTAAAPsPVRPTPAPSTRP--KAAAAANIPPKEPVRETATPPPVPPRPVAPPVPHTPESAPKLTRAAIPV 438
                         90       100
                 ....*....|....*....|....
gi 297280195 422 SAPDTSAAPGSTGPPARVVTSAPD 445
Cdd:PRK14950 439 DEKPKYTPPAPPKEEEKALIADGD 462
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
323-425 9.54e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 41.33  E-value: 9.54e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 323 APDTSAAPGSTGPPAR-VVTSAPDTSAAPgsTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVT 401
Cdd:PRK14950 361 VPVPAPQPAKPTAAAPsPVRPTPAPSTRP--KAAAAANIPPKEPVRETATPPPVPPRPVAPPVPHTPESAPKLTRAAIPV 438
                         90       100
                 ....*....|....*....|....
gi 297280195 402 SAPDTSAAPGSTGPPARVVTSAPD 425
Cdd:PRK14950 439 DEKPKYTPPAPPKEEEKALIADGD 462
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
303-405 9.54e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 41.33  E-value: 9.54e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 303 APDTSAAPGSTGPPAR-VVTSAPDTSAAPgsTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVT 381
Cdd:PRK14950 361 VPVPAPQPAKPTAAAPsPVRPTPAPSTRP--KAAAAANIPPKEPVRETATPPPVPPRPVAPPVPHTPESAPKLTRAAIPV 438
                         90       100
                 ....*....|....*....|....
gi 297280195 382 SAPDTSAAPGSTGPPARVVTSAPD 405
Cdd:PRK14950 439 DEKPKYTPPAPPKEEEKALIADGD 462
PRK14950 PRK14950
DNA polymerase III subunits gamma and tau; Provisional
363-465 9.54e-04

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237864 [Multi-domain]  Cd Length: 585  Bit Score: 41.33  E-value: 9.54e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 363 APDTSAAPGSTGPPAR-VVTSAPDTSAAPgsTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVT 441
Cdd:PRK14950 361 VPVPAPQPAKPTAAAPsPVRPTPAPSTRP--KAAAAANIPPKEPVRETATPPPVPPRPVAPPVPHTPESAPKLTRAAIPV 438
                         90       100
                 ....*....|....*....|....
gi 297280195 442 SAPDTSAAPGSTGPPARVVTSAPD 465
Cdd:PRK14950 439 DEKPKYTPPAPPKEEEKALIADGD 462
PLN02217 PLN02217
probable pectinesterase/pectinesterase inhibitor
275-361 9.57e-04

probable pectinesterase/pectinesterase inhibitor


Pssm-ID: 215130 [Multi-domain]  Cd Length: 670  Bit Score: 41.23  E-value: 9.57e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 275 TQGQDVTLALAMEPATGSATTLGHNVTSAPDTSAAPgSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTG 354
Cdd:PLN02217 582 TTFSSDSPSTVVAPSTSPPAGHLGSPPATPSKIVSP-STSPPASHLGSPSTTPSSPESSIKVASTETASPESSIKVASTE 660

                 ....*..
gi 297280195 355 PPARVVT 361
Cdd:PLN02217 661 SSVSMVS 667
PHA03325 PHA03325
nuclear-egress-membrane-like protein; Provisional
290-435 9.60e-04

nuclear-egress-membrane-like protein; Provisional


Pssm-ID: 223044 [Multi-domain]  Cd Length: 418  Bit Score: 41.02  E-value: 9.60e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 290 TGSATTLGHNV-TSAPDTSAApgSTGPPARVVTSAPDTSAAPGS----------TGPPARVVTSAPDTSAAPGSTGPPAR 358
Cdd:PHA03325 258 TSSAFMLNSSLpTSAPKRRSR--RAGAMRAAAGETADLADDDGSehsdpeplpaSLPPPPVRRPRVKHPEAGKEEPDGAR 335
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 297280195 359 VVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGP 435
Cdd:PHA03325 336 NAEAKEPAQPATSTSSKGSSSAQNKDSGSTGPGSSLAAASSFLEDDDFGSPPLDLTTSLRHMPSPSVTSAPEPPSIP 412
PHA03247 PHA03247
large tegument protein UL36; Provisional
309-475 1.24e-03

large tegument protein UL36; Provisional


Pssm-ID: 223021 [Multi-domain]  Cd Length: 3151  Bit Score: 41.08  E-value: 1.24e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  309 APGSTGPPARVVTSAPDTSAAPGSTGPParvvtsapDTSAAPGSTGPPARVVTSAPdtsaaPGSTGPPaRVVT------- 381
Cdd:PHA03247 2477 APVYRRPAEARFPFAAGAAPDPGGGGPP--------DPDAPPAPSRLAPAILPDEP-----VGEPVHP-RMLTwirglee 2542
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  382 SAPDTSAAPGSTGPPArVVTSAPDTSA-----APGSTGPPARVVTSAPDtsAAPGSTGPPARVVTSAPDTSAAPGSTGPP 456
Cdd:PHA03247 2543 LASDDAGDPPPPLPPA-APPAAPDRSVppprpAPRPSEPAVTSRARRPD--APPQSARPRAPVDDRGDPRGPAPPSPLPP 2619
                         170
                  ....*....|....*....
gi 297280195  457 ArvvTSAPDTRPPGSTAPP 475
Cdd:PHA03247 2620 D---THAPDPPPPSPSPAA 2635
motB PRK12799
flagellar motor protein MotB; Reviewed
331-453 1.37e-03

flagellar motor protein MotB; Reviewed


Pssm-ID: 183756 [Multi-domain]  Cd Length: 421  Bit Score: 40.47  E-value: 1.37e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 331 GSTGPPARVVTSAPDTSAAPGSTGP--PARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSA 408
Cdd:PRK12799 297 GTVPVAAVTPSSAVTQSSAITPSSAaiPSPAVIPSSVTTQSATTTQASAVALSSAGVLPSDVTLPGTVALPAAEPVNMQP 376
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 297280195 409 APGSTGPPARVVTSAPDTSAAPGSTGPPArvvtsAPDTSAAPGST 453
Cdd:PRK12799 377 QPMSTTETQQSSTGNITSTANGPTTSLPA-----APASNIPVSPT 416
motB PRK12799
flagellar motor protein MotB; Reviewed
311-433 1.37e-03

flagellar motor protein MotB; Reviewed


Pssm-ID: 183756 [Multi-domain]  Cd Length: 421  Bit Score: 40.47  E-value: 1.37e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 311 GSTGPPARVVTSAPDTSAAPGSTGP--PARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSA 388
Cdd:PRK12799 297 GTVPVAAVTPSSAVTQSSAITPSSAaiPSPAVIPSSVTTQSATTTQASAVALSSAGVLPSDVTLPGTVALPAAEPVNMQP 376
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 297280195 389 APGSTGPPARVVTSAPDTSAAPGSTGPPArvvtsAPDTSAAPGST 433
Cdd:PRK12799 377 QPMSTTETQQSSTGNITSTANGPTTSLPA-----APASNIPVSPT 416
motB PRK12799
flagellar motor protein MotB; Reviewed
288-413 1.45e-03

flagellar motor protein MotB; Reviewed


Pssm-ID: 183756 [Multi-domain]  Cd Length: 421  Bit Score: 40.47  E-value: 1.45e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 288 PATGSATTLGHNVTSAPDTSaapgSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTS 367
Cdd:PRK12799 300 PVAAVTPSSAVTQSSAITPS----SAAIPSPAVIPSSVTTQSATTTQASAVALSSAGVLPSDVTLPGTVALPAAEPVNMQ 375
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 297280195 368 AAPGSTGPPARVVTSAPDTSAAPGSTGPPArvvtsAPDTSAAPGST 413
Cdd:PRK12799 376 PQPMSTTETQQSSTGNITSTANGPTTSLPA-----APASNIPVSPT 416
PRK14971 PRK14971
DNA polymerase III subunits gamma and tau; Provisional
351-475 1.67e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237874 [Multi-domain]  Cd Length: 614  Bit Score: 40.53  E-value: 1.67e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 351 GSTGPPARvvtsAPDTSAAPGSTGP-PARVVTSAPDTSAAPGSTGPPArvvtsapdTSAAPGSTGPPArvvTSAPDTSAA 429
Cdd:PRK14971 366 GDDASGGR----GPKQHIKPVFTQPaAAPQPSAAAAASPSPSQSSAAA--------QPSAPQSATQPA---GTPPTVSVD 430
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*.
gi 297280195 430 PGSTGPparvvtsAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAPP 475
Cdd:PRK14971 431 PPAAVP-------VNPPSTAPQAVRPAQFKEEKKIPVSKVSSLGPS 469
Ro_ribonucleoprotein-binding_protein_1 TIGR01645
poly-U binding splicing factor, half-pint family; The proteins represented by this model ...
291-415 1.75e-03

poly-U binding splicing factor, half-pint family; The proteins represented by this model contain three RNA recognition motifs (rrm: pfam00076) and have been characterized as poly-pyrimidine tract binding proteins associated with RNA splicing factors. In the case of PUF60 (GP|6176532), in complex with p54, and in the presence of U2AF, facilitates association of U2 snRNP with pre-mRNA.


Pssm-ID: 130706 [Multi-domain]  Cd Length: 612  Bit Score: 40.44  E-value: 1.75e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  291 GSATTLGHNVTSaPDTSAAPGSTG--PPARVVTSAPDTS------AAPGSTGPPARVVTSAPDTSAAPGSTGPPArvVTS 362
Cdd:TIGR01645 273 GQYLRVGKCVTP-PDALLQPATVSaiPAAAAVAAAAATAkimaaeAVAGAAVLGPRAQSPATPSSSLPTDIGNKA--VVS 349
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
gi 297280195  363 APDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVtsaPDTSAAPGSTGP 415
Cdd:TIGR01645 350 SAKKEAEEVPPLPQAAPAVVKPGPMEIPTPVPPPGLAI---PSLVAPPGLVAP 399
dnaA PRK14086
chromosomal replication initiation protein; Provisional
305-473 1.90e-03

chromosomal replication initiation protein; Provisional


Pssm-ID: 237605 [Multi-domain]  Cd Length: 617  Bit Score: 40.19  E-value: 1.90e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 305 DTSAAPGSTGPPARVVTSAPDTSAA-----PGSTGPPARVVTSAPdtsaAPGSTGPPARVVTSAPDTSAAPGSTGPPA-- 377
Cdd:PRK14086  89 DPSAGEPAPPPPHARRTSEPELPRPgrrpyEGYGGPRADDRPPGL----PRQDQLPTARPAYPAYQQRPEPGAWPRAAdd 164
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 378 ------RVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTG------------PPARVVTSAPDT---SAAPGSTGPP 436
Cdd:PRK14086 165 ygwqqqRLGFPPRAPYASPASYAPEQERDREPYDAGRPEYDQRrrdydhprpdwdRPRRDRTDRPEPppgAGHVHRGGPG 244
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 297280195 437 ARVVTSAPDTSAAPGSTGPPARvvTSAPDTRPPGSTA 473
Cdd:PRK14086 245 PPERDDAPVVPIRPSAPGPLAA--QPAPAPGPGEPTA 279
PRK10856 PRK10856
cytoskeletal protein RodZ; Provisional
300-409 2.18e-03

cytoskeletal protein RodZ; Provisional


Pssm-ID: 236776 [Multi-domain]  Cd Length: 331  Bit Score: 39.62  E-value: 2.18e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 300 VTSAPDTSAAPGSTGPPARVVTSApDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPArV 379
Cdd:PRK10856 143 ITTMADQSSAELSQNSGQSVPLDT-STTTDPATTPAPAAPVDTTPTNSQTPAVATAPAPAVDPQQNAVVAPSQANVDT-A 220
                         90       100       110
                 ....*....|....*....|....*....|
gi 297280195 380 VTSAPDTSAAPgSTGPPARVVTSAPDTSAA 409
Cdd:PRK10856 221 ATPAPAAPATP-DGAAPLPTDQAGVSTPAA 249
PRK10856 PRK10856
cytoskeletal protein RodZ; Provisional
320-429 2.18e-03

cytoskeletal protein RodZ; Provisional


Pssm-ID: 236776 [Multi-domain]  Cd Length: 331  Bit Score: 39.62  E-value: 2.18e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 320 VTSAPDTSAAPGSTGPPARVVTSApDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPArV 399
Cdd:PRK10856 143 ITTMADQSSAELSQNSGQSVPLDT-STTTDPATTPAPAAPVDTTPTNSQTPAVATAPAPAVDPQQNAVVAPSQANVDT-A 220
                         90       100       110
                 ....*....|....*....|....*....|
gi 297280195 400 VTSAPDTSAAPgSTGPPARVVTSAPDTSAA 429
Cdd:PRK10856 221 ATPAPAAPATP-DGAAPLPTDQAGVSTPAA 249
PRK10856 PRK10856
cytoskeletal protein RodZ; Provisional
340-449 2.18e-03

cytoskeletal protein RodZ; Provisional


Pssm-ID: 236776 [Multi-domain]  Cd Length: 331  Bit Score: 39.62  E-value: 2.18e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 340 VTSAPDTSAAPGSTGPPARVVTSApDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPArV 419
Cdd:PRK10856 143 ITTMADQSSAELSQNSGQSVPLDT-STTTDPATTPAPAAPVDTTPTNSQTPAVATAPAPAVDPQQNAVVAPSQANVDT-A 220
                         90       100       110
                 ....*....|....*....|....*....|
gi 297280195 420 VTSAPDTSAAPgSTGPPARVVTSAPDTSAA 449
Cdd:PRK10856 221 ATPAPAAPATP-DGAAPLPTDQAGVSTPAA 249
Ro_ribonucleoprotein-binding_protein_1 TIGR01645
poly-U binding splicing factor, half-pint family; The proteins represented by this model ...
344-455 2.22e-03

poly-U binding splicing factor, half-pint family; The proteins represented by this model contain three RNA recognition motifs (rrm: pfam00076) and have been characterized as poly-pyrimidine tract binding proteins associated with RNA splicing factors. In the case of PUF60 (GP|6176532), in complex with p54, and in the presence of U2AF, facilitates association of U2 snRNP with pre-mRNA.


Pssm-ID: 130706 [Multi-domain]  Cd Length: 612  Bit Score: 40.05  E-value: 2.22e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  344 PDTSAAPGSTG--PPARVVTSAPDTS------AAPGSTGPPARVVTSAPDTSAAPGSTGPPArvVTSAPDTSAAPGSTGP 415
Cdd:TIGR01645 285 PDALLQPATVSaiPAAAAVAAAAATAkimaaeAVAGAAVLGPRAQSPATPSSSLPTDIGNKA--VVSSAKKEAEEVPPLP 362
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 297280195  416 PARVVTSAPDTSAAPGSTGPPARVVtsaPDTSAAPGSTGP 455
Cdd:TIGR01645 363 QAAPAVVKPGPMEIPTPVPPPGLAI---PSLVAPPGLVAP 399
Ro_ribonucleoprotein-binding_protein_1 TIGR01645
poly-U binding splicing factor, half-pint family; The proteins represented by this model ...
324-435 2.22e-03

poly-U binding splicing factor, half-pint family; The proteins represented by this model contain three RNA recognition motifs (rrm: pfam00076) and have been characterized as poly-pyrimidine tract binding proteins associated with RNA splicing factors. In the case of PUF60 (GP|6176532), in complex with p54, and in the presence of U2AF, facilitates association of U2 snRNP with pre-mRNA.


Pssm-ID: 130706 [Multi-domain]  Cd Length: 612  Bit Score: 40.05  E-value: 2.22e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  324 PDTSAAPGSTG--PPARVVTSAPDTS------AAPGSTGPPARVVTSAPDTSAAPGSTGPPArvVTSAPDTSAAPGSTGP 395
Cdd:TIGR01645 285 PDALLQPATVSaiPAAAAVAAAAATAkimaaeAVAGAAVLGPRAQSPATPSSSLPTDIGNKA--VVSSAKKEAEEVPPLP 362
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|
gi 297280195  396 PARVVTSAPDTSAAPGSTGPPARVVtsaPDTSAAPGSTGP 435
Cdd:TIGR01645 363 QAAPAVVKPGPMEIPTPVPPPGLAI---PSLVAPPGLVAP 399
TIGR03809 TIGR03809
TIGR03809 family protein; This protein family contains proteins with a median length of about ...
396-468 2.26e-03

TIGR03809 family protein; This protein family contains proteins with a median length of about 175, including a strongly conserved N-terminal region of about 55 amino acids, a conserved extreme C-terminal region of about 15 amino acids, and highly variable sequence in between the two. Members are found invariably with a member of family TIGR03808.


Pssm-ID: 163521 [Multi-domain]  Cd Length: 168  Bit Score: 38.28  E-value: 2.26e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 297280195  396 PARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARvvtSAPDTSAAPGSTGPPARVVTSAPDTRP 468
Cdd:TIGR03809  78 PPRAPFYAADETVEPRRFAPPAALPASAPAIVALPEEAAAEPR---AAPDVPAEPNDASDADVAEVAEPDVVP 147
PRK04654 PRK04654
sec-independent translocase; Provisional
305-395 2.47e-03

sec-independent translocase; Provisional


Pssm-ID: 135173 [Multi-domain]  Cd Length: 214  Bit Score: 39.02  E-value: 2.47e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 305 DTSAAPGSTGPparvVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPA--RVVTSAPDTSAAPGSTGPPARVVTS 382
Cdd:PRK04654 118 DLSASAQVDAA----AGAEPGAGQAHTPVPAPAPVIAQAQPIAPAPHQTLVPAphDTIVPAPHAAHLPSAPATPVSVAPV 193
                         90
                 ....*....|...
gi 297280195 383 APDTSAAPGSTGP 395
Cdd:PRK04654 194 DAGTSASPTPSEP 206
PRK04654 PRK04654
sec-independent translocase; Provisional
325-415 2.47e-03

sec-independent translocase; Provisional


Pssm-ID: 135173 [Multi-domain]  Cd Length: 214  Bit Score: 39.02  E-value: 2.47e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 325 DTSAAPGSTGPparvVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPA--RVVTSAPDTSAAPGSTGPPARVVTS 402
Cdd:PRK04654 118 DLSASAQVDAA----AGAEPGAGQAHTPVPAPAPVIAQAQPIAPAPHQTLVPAphDTIVPAPHAAHLPSAPATPVSVAPV 193
                         90
                 ....*....|...
gi 297280195 403 APDTSAAPGSTGP 415
Cdd:PRK04654 194 DAGTSASPTPSEP 206
PRK04654 PRK04654
sec-independent translocase; Provisional
345-435 2.47e-03

sec-independent translocase; Provisional


Pssm-ID: 135173 [Multi-domain]  Cd Length: 214  Bit Score: 39.02  E-value: 2.47e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 345 DTSAAPGSTGPparvVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPA--RVVTSAPDTSAAPGSTGPPARVVTS 422
Cdd:PRK04654 118 DLSASAQVDAA----AGAEPGAGQAHTPVPAPAPVIAQAQPIAPAPHQTLVPAphDTIVPAPHAAHLPSAPATPVSVAPV 193
                         90
                 ....*....|...
gi 297280195 423 APDTSAAPGSTGP 435
Cdd:PRK04654 194 DAGTSASPTPSEP 206
PRK04654 PRK04654
sec-independent translocase; Provisional
365-455 2.47e-03

sec-independent translocase; Provisional


Pssm-ID: 135173 [Multi-domain]  Cd Length: 214  Bit Score: 39.02  E-value: 2.47e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 365 DTSAAPGSTGPparvVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPA--RVVTSAPDTSAAPGSTGPPARVVTS 442
Cdd:PRK04654 118 DLSASAQVDAA----AGAEPGAGQAHTPVPAPAPVIAQAQPIAPAPHQTLVPAphDTIVPAPHAAHLPSAPATPVSVAPV 193
                         90
                 ....*....|...
gi 297280195 443 APDTSAAPGSTGP 455
Cdd:PRK04654 194 DAGTSASPTPSEP 206
PHA03255 PHA03255
BDLF3; Provisional
321-474 2.56e-03

BDLF3; Provisional


Pssm-ID: 165513 [Multi-domain]  Cd Length: 234  Bit Score: 39.12  E-value: 2.56e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 321 TSAPDTSAAPGSTGPPArvVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVV 400
Cdd:PHA03255  26 SSGSSTASAGNVTGTTA--VTTPSPSASGPSTNQSTTLTTTSAPITTTAILSTNTTTVTSTGTTVTPVPTTSNASTINVT 103
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 297280195 401 TSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARvVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTAP 474
Cdd:PHA03255 104 TKVTAQNITATEAGTGTSTGVTSNVTTRSSSTTSATTR-ITNATTLAPTLSSKGTSNATKTTAELPTVPDERQP 176
PRK07003 PRK07003
DNA polymerase III subunits gamma and tau; Validated
363-555 2.99e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 235906 [Multi-domain]  Cd Length: 830  Bit Score: 39.83  E-value: 2.99e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 363 APDTSAapGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTS 442
Cdd:PRK07003 341 APDEYA--GFTMTLLRMLAFEPAVTGGGAPGGGVPARVAGAVPAPGARAAAAVGASAVPAVTAVTGAAGAALAPKAAAAA 418
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 443 APDTSAAPGSTGPPARVVTSAPDTRPPGSTAPPAHDVTSASDSASGSASTLVHSTTSARATTTPASKSTPFSIPSHHSDT 522
Cdd:PRK07003 419 AATRAEAPPAAPAPPATADRGDDAADGDAPVPAKANARASADSRCDERDAQPPADSGSASAPASDAPPDAAFEPAPRAAA 498
                        170       180       190
                 ....*....|....*....|....*....|....*..
gi 297280195 523 PTTLASHSTKTD----ASSTHHSTVPPFTSSNHSTSP 555
Cdd:PRK07003 499 PSAATPAAVPDArapaAASREDAPAAAAPPAPEARPP 535
PRK11907 PRK11907
bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase ...
282-384 3.00e-03

bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed


Pssm-ID: 237019 [Multi-domain]  Cd Length: 814  Bit Score: 39.84  E-value: 3.00e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 282 LALAMEPATGSATTLGHN---VTSAPDTSAAPGSTGPparVVTSAPDTSAAPgSTGPPARVVTSAPDTSAAPGSTGPPAR 358
Cdd:PRK11907  11 VALTLALLTASNPKLAQAeeiVTTTPATSTEAEQTTP---VESDATEEADNT-ETPVAATTAAEAPSSSETAETSDPTSE 86
                         90       100
                 ....*....|....*....|....*.
gi 297280195 359 VVTSAPDTSAAPgstgPPARVVTSAP 384
Cdd:PRK11907  87 ATDTTTSEARTV----TPAATETSKP 108
PRK08691 PRK08691
DNA polymerase III subunits gamma and tau; Validated
233-477 3.18e-03

DNA polymerase III subunits gamma and tau; Validated


Pssm-ID: 236333 [Multi-domain]  Cd Length: 709  Bit Score: 39.69  E-value: 3.18e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 233 STPGGEKETSATQ--------RSSMPISTKNAVSMTSRlsshspvsgssttqgqdvtlALAMEPATGSATTLGHNVTSAP 304
Cdd:PRK08691 381 SAQTAEKETAAKKpqprpeaeTAQTPVQTASAAAMPSE--------------------GKTAGPVSNQENNDVPPWEDAP 440
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 305 DTSAAPGSTGP-PARVVTSAPDTSAAPGSTGPPARvvtSAPDTSAAPGSTGPPARVVTSAPDTSAAPGST-----GPPAR 378
Cdd:PRK08691 441 DEAQTAAGTAQtSAKSIQTASEAETPPENQVSKNK---AADNETDAPLSEVPSENPIQATPNDEAVETETfaheaPAEPF 517
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 379 VVTSAPDTSAAP--GSTGPPARVVTSAPDTSAAPGStgpparvvtsapDTSAAPGSTGPParvvtSAPDTSAAPGSTGPP 456
Cdd:PRK08691 518 YGYGFPDNDCPPedGAEIPPPDWEHAAPADTAGGGA------------DEEAEAGGIGGN-----NTPSAPPPEFSTENW 580
                        250       260
                 ....*....|....*....|.
gi 297280195 457 ARVVtsAPDTRPPGSTAPPAH 477
Cdd:PRK08691 581 AAIV--RHFARKLGAAQMPAQ 599
PRK14971 PRK14971
DNA polymerase III subunits gamma and tau; Provisional
297-395 3.35e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237874 [Multi-domain]  Cd Length: 614  Bit Score: 39.37  E-value: 3.35e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 297 GHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAP--DTSAAPGSTGPPARVVTSAPDTSAApGSTG 374
Cdd:PRK14971 389 APQPSAAAAASPSPSQSSAAAQPSAPQSATQPAGTPPTVSVDPPAAVPvnPPSTAPQAVRPAQFKEEKKIPVSKV-SSLG 467
                         90       100
                 ....*....|....*....|....*
gi 297280195 375 P----PARVVTSAPDTSAAPGSTGP 395
Cdd:PRK14971 468 PstlrPIQEKAEQATGNIKEAPTGT 492
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
316-475 3.39e-03

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 251763 [Multi-domain]  Cd Length: 979  Bit Score: 39.67  E-value: 3.39e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  316 PARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGS--- 392
Cdd:pfam03154 365 PPHLQGPSPFPQMPSNLPPPPALKPLSSLPTHHPPSAHPPPLQLMPQSQPLQSVPAQPPVLTQSQSLPPKASTHPHSglh 444
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  393 TGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTRPPGST 472
Cdd:pfam03154 445 SGPPQSPFAQHPFTSGGLPAIGPPPSLPTSTPAAPPRASSGSQPPGSALPSSGGCAGPGPPLPPIQIKEEPLDEAEEPES 524

                  ...
gi 297280195  473 APP 475
Cdd:pfam03154 525 PPP 527
PRK04654 PRK04654
sec-independent translocase; Provisional
300-375 3.48e-03

sec-independent translocase; Provisional


Pssm-ID: 135173 [Multi-domain]  Cd Length: 214  Bit Score: 38.25  E-value: 3.48e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 297280195 300 VTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPA--RVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGP 375
Cdd:PRK04654 129 AGAEPGAGQAHTPVPAPAPVIAQAQPIAPAPHQTLVPAphDTIVPAPHAAHLPSAPATPVSVAPVDAGTSASPTPSEP 206
PHA03377 PHA03377
EBNA-3C; Provisional
302-475 4.12e-03

EBNA-3C; Provisional


Pssm-ID: 177614 [Multi-domain]  Cd Length: 1000  Bit Score: 39.27  E-value: 4.12e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  302 SAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPParVVTSAPDTSAAPGSTGPPARVVT 381
Cdd:PHA03377  574 STGPRVMATPSTGPRDMAPPSTGPRQQAKCKDGPPASGPHEKQPPSSAPRDMAPS--VVRMFLRERLLEQSTGPKPKSFW 651
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  382 SAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDT-SAAPGSTGPPARV- 459
Cdd:PHA03377  652 EMRAGRDGSGIQQEPSSRRQPATQSTPPRPSWLPSVFVLPSVDAGRAQPSEESHLSSMSPTQPIShEEQPRYEDPDDPLd 731
                         170
                  ....*....|....*.
gi 297280195  460 VTSAPDTRPPGSTAPP 475
Cdd:PHA03377  732 LSLHPDQAPPPSHQAP 747
motB PRK05996
flagellar motor protein MotB; Validated
305-440 5.53e-03

flagellar motor protein MotB; Validated


Pssm-ID: 235665 [Multi-domain]  Cd Length: 423  Bit Score: 38.53  E-value: 5.53e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 305 DTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPgstGPPARVVTSAPDTsAAPGSTGPPARVVTSAP 384
Cdd:PRK05996 193 TTAGDLLPPGQAREQAQGAKSATAAPATVPQAAPLPQAQPKKAATE---EELIADAKKAATG-EPAANAAKAAKPEPMPD 268
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 297280195 385 DTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPAR--VVTSAPDTSAAP----GSTGPPARVV 440
Cdd:PRK05996 269 DQQKEAEQLQAAIAQAIGGVAGKLAEGVTVTPVEggLLISLTDQVDYGmfaiGSAVPRAELV 330
PRK13108 PRK13108
prolipoprotein diacylglyceryl transferase; Reviewed
287-478 5.82e-03

prolipoprotein diacylglyceryl transferase; Reviewed


Pssm-ID: 237284 [Multi-domain]  Cd Length: 460  Bit Score: 38.42  E-value: 5.82e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 287 EPATGSATTLghnvtSAPDTSAAPGSTGPparvvtsapdtsAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDT 366
Cdd:PRK13108 294 EALEREPAEL-----AAAAVASAASAVGP------------VGPGEPNQPDDVAEAVKAEVAEVTDEVAAESVVQVADRD 356
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 367 SAAPGSTGPPAR--VVTSAPDTSAAPGSTGPParvvTSAPDTSAAPGStgpparvvtSAPDTSAAPGSTGPparvvtSAP 444
Cdd:PRK13108 357 GESTPAVEETSEadIEREQPGDLAGQAPAAHQ----VDAEAASAAPEE---------PAALASEAHDETEP------EVP 417
                        170       180       190
                 ....*....|....*....|....*....|....
gi 297280195 445 DTSAAPGSTGPPARVVTSAPDTRPPGSTAPPAHD 478
Cdd:PRK13108 418 EKAAPIPDPAKPDELAVAGPGDDPAEPDGIRRQD 451
PRK10905 PRK10905
cell division protein DamX; Validated
283-457 6.27e-03

cell division protein DamX; Validated


Pssm-ID: 236792 [Multi-domain]  Cd Length: 328  Bit Score: 38.00  E-value: 6.27e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 283 ALAMEPATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPD----TSAAPGSTGP--P 356
Cdd:PRK10905  48 ANGVQPAPGTTSAEQTAGNTQQDVSLPPISSTPTQGQTPVATDGQQRVEVQGDLNNALTQPQNqqqlNNVAVNSTLPteP 127
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 357 ArvvTSAP----DTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPArvVTSAPDTSAAPGS 432
Cdd:PRK10905 128 A---TVAPvrngNASRQTAKTQTAERPATTRPARKQAVIEPKKPQATAKTEPKPVAQTPKRTEPA--APVASTKAPAATS 202
                        170       180
                 ....*....|....*....|....*
gi 297280195 433 TGPPARVVTSAPDTSAAPGSTGPPA 457
Cdd:PRK10905 203 TPAPKETATTAPVQTASPAQTTATP 227
PHA03291 PHA03291
envelope glycoprotein I; Provisional
282-412 7.00e-03

envelope glycoprotein I; Provisional


Pssm-ID: 223033 [Multi-domain]  Cd Length: 401  Bit Score: 38.01  E-value: 7.00e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 282 LALAMEPATGSATTLGHNVTSApDTSAAPGSTGPPARVvtsAPDTSAAPGSTGPPARvvtsapdTSAAPGSTGPPARVVT 361
Cdd:PHA03291 161 LGLAAFPAEGTLAAPPLGEGSA-DGSCDPALPLSAPRL---GPADVFVPATPRPTPR-------TTASPETTPTPSTTTS 229
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 297280195 362 SAPDTSAAPGSTGPPArvvtSAPDTSAAPGSTGPPARVVTSAPDTSAAPGS 412
Cdd:PHA03291 230 PPSTTIPAPSTTIAAP----QAGTTPEAEGTPAPPTPGGGEAPPANATPAP 276
PRK14951 PRK14951
DNA polymerase III subunits gamma and tau; Provisional
281-384 7.96e-03

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237865 [Multi-domain]  Cd Length: 618  Bit Score: 38.16  E-value: 7.96e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 281 TLALAMEPATGSATTlghnVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVV 360
Cdd:PRK14951 398 AAAPAPAAAPAAAAS----APAAPPAAAPPAPVAAPAAAAPAAAPAAAPAAVALAPAPPAQAAPETVAIPVRVAPEPAVA 473
                         90       100
                 ....*....|....*....|....
gi 297280195 361 TSAPDTSAAPgstgPPARVVTSAP 384
Cdd:PRK14951 474 SAAPAPAAAP----AAARLTPTEE 493
Med3 pfam11593
Mediator complex subunit 3 fungal; Mediator is a large complex of up to 33 proteins that is ...
281-476 8.90e-03

Mediator complex subunit 3 fungal; Mediator is a large complex of up to 33 proteins that is conserved from plants to fungi to humans - the number and representation of individual subunits varying with species. It is arranged into four different sections, a core, a head, a tail and a kinase-activity part, and the number of subunits within each of these is what varies with species. Overall, Mediator regulates the transcriptional activity of RNA polymerase II but it would appear that each of the four different sections has a slightly different function. Mediator subunit Hrs1/Med3 is a physical target for Cyc8-Tup1, a yeast transcriptional co-repressor.


Pssm-ID: 256520 [Multi-domain]  Cd Length: 381  Bit Score: 37.69  E-value: 8.90e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  281 TLALAMEPATGSATTlGHNVTSAPDTSAAPGSTgpparvvtsAPDTSAAPGSTGPPArvvtSAPDTSAAPGSTGPPARVV 360
Cdd:pfam11593 115 TLGTYNQLGNAGASA-SITKTSNGSDAATTSST---------ANTPAAAKVLKANAA----SAPNTTTGVGSAATTAAIS 180
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  361 TSapdTSAAPGSTgpparvvTSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGPPARVVTSAPDTSAA---PGSTGPPA 437
Cdd:pfam11593 181 AT---TATTPTTT-------QKKPRKPRQTKKTGPAAAAKAQASAQAQAQASAYNQMGSLGVPQNTSMLaqiPNPTPLMQ 250
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 297280195  438 RVVTSAPDTS-AAPGSTGPPARVVTSAPDTRPPGSTAPPA 476
Cdd:pfam11593 251 LLNGVSPNNAmASPLNNMSPMRNLNQMGNQNNGGQMTPSA 290
PDHac_trf_mito TIGR01349
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form; This model ...
275-394 9.36e-03

pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form; This model represents one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex. It includes sequences from mitochondria and from alpha and beta branches of the proteobacteria, as well as from some other bacteria. Sequences from Gram-positive bacteria are not included. The non-enzymatic homolog protein X, which serves as an E3 component binding protein, falls within the clade phylogenetically but is rejected by its low score. [Energy metabolism, Pyruvate dehydrogenase]


Pssm-ID: 273567 [Multi-domain]  Cd Length: 436  Bit Score: 37.85  E-value: 9.36e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  275 TQGQDVtlALAMEPATGSATTLGHNVTSAPDTSAAPGSTGPPARVVTSAPDTSA-APGSTGPPARVVTSAP--------- 344
Cdd:TIGR01349  76 EEKEDV--ADAFKNYKLESSASPAPKPSEIAPTAPPSAPKPSPAPQKQSPEPSSpAPLSDKESGDRIFASPlakklakek 153
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....
gi 297280195  345 --DTSAAPGStGPPARVVTSAPDT--SAAPGSTGPPARVVTSAPDTSAAPGSTG 394
Cdd:TIGR01349 154 giDLSAVAGS-GPNGRIVKKDIESfvPQSPASANQQAAATTPATYPAAAPVSTG 206
Herpes_UL32 pfam06070
Herpesvirus large structural phosphoprotein UL32; The large phosphorylated protein (UL32-like) ...
308-536 9.91e-03

Herpesvirus large structural phosphoprotein UL32; The large phosphorylated protein (UL32-like) of herpes viruses is the polypeptide most frequently reactive in immuno-blotting analyses with antisera when compared with other viral proteins.


Pssm-ID: 253544 [Multi-domain]  Cd Length: 777  Bit Score: 37.97  E-value: 9.91e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  308 AAPGSTGPPARVVTSAPDTSAAPGSTGPparvVTSAPDTSAAPGSTGPPARvvtsAPDTSAAPGSTGPPARVVTSAPDTS 387
Cdd:pfam06070 463 KVIDSVSPPSKRRVSAPASRLDDAKRPE----VTATPESSGSDSEGGASGR----EDETSSDAESVVSIKELRPRIGFIN 534
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195  388 AAPGSTGPPARVVTSAPDTSAAPGSTGPPARvvtSAPDTSAAPGSTGPPARVVTSAPDTSAAPGSTGP----PARVVTSA 463
Cdd:pfam06070 535 KSPPPKSPPKSRRTLIVALSLASPSTAGSPR---PKPSLGKFVIGTDPFAFANTVRLTDNMRGGNGVGssvkPKGSASSK 611
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 297280195  464 PDTRPPGSTAPPAHDVTSASDSASGSASTlvhsTTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDAS 536
Cdd:pfam06070 612 PLTGPGSDLKPATLNGKTPSSSLVGAARN----AGASSKVKIPSGLGGFTSPISLLESALEDVLTSATSTPVK 680
PRK00708 PRK00708
sec-independent translocase; Provisional
346-473 9.92e-03

sec-independent translocase; Provisional


Pssm-ID: 234818 [Multi-domain]  Cd Length: 209  Bit Score: 37.10  E-value: 9.92e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 297280195 346 TSAAPGSTGPPARVVTSAPDTSAapGSTGPPARVVTSAPDTSAApgstgppARVVTSAPDTSAAPgstgppaRVVTSAPD 425
Cdd:PRK00708 101 SMSEPATENKPAEVTTPVEPMGL--PETPPAVPVPAPAPAVAAA-------AAQAAAAPKAPAKP-------RAKSPRPA 164
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 297280195 426 TSAAPGSTGPPArvvTSAPDTSAAPGSTGPPARVVTSAPDTRPPGSTA 473
Cdd:PRK00708 165 AKAAPKPTETIT---AKKAKKTAAAPKPTADKTATPAKKTTKKKKTKA 209
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH