NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|296439460|sp|Q96QE3|]
View 

RecName: Full=ATPase family AAA domain-containing protein 5; AltName: Full=Chromosome fragility-associated gene 1 protein [Homo sapiens]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
1126-1160 3.35e-05

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


:

Pssm-ID: 99707  Cd Length: 151  Bit Score: 44.44  E-value: 3.35e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 296439460 1126 NTVLITGPTGVGKTAAVYACAQEL---GFKIFEVNASS 1160
Cdd:cd00009    20 KNLLLYGPPGTGKTTLARAIANELfrpGAPFLYLNASD 57
 
Name Accession Description Interval E-value
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
1126-1160 3.35e-05

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707  Cd Length: 151  Bit Score: 44.44  E-value: 3.35e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 296439460 1126 NTVLITGPTGVGKTAAVYACAQEL---GFKIFEVNASS 1160
Cdd:cd00009    20 KNLLLYGPPGTGKTTLARAIANELfrpGAPFLYLNASD 57
AAA pfam00004
ATPase family associated with various cellular activities (AAA); AAA family proteins often ...
1128-1173 1.41e-06

ATPase family associated with various cellular activities (AAA); AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.


Pssm-ID: 249500  Cd Length: 131  Bit Score: 48.75  E-value: 1.41e-06
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 296439460  1128 VLITGPTGVGKTAAVYACAQELGFKIFEVNASSQRSG---------RQILSQLKE 1173
Cdd:pfam00004    1 LLLYGPPGTGKTTLAKAVAKELGAPFIEISGSELVSKyvgesekrlRELFEAAKK 55
PRK04195 PRK04195
replication factor C large subunit; Provisional
1051-1167 1.55e-14

replication factor C large subunit; Provisional


Pssm-ID: 235250 [Multi-domain]  Cd Length: 482  Bit Score: 77.27  E-value: 1.55e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439460 1051 DMLWTEKYQPQTASELIGNELAIKKLHSWLKDWKRraeleerqnlkgkrdekhedfsgGIDFKgssddeeesrlcnTVLI 1130
Cdd:PRK04195    1 MMPWVEKYRPKTLSDVVGNEKAKEQLREWIESWLK-----------------------GKPKK-------------ALLL 44
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 296439460 1131 TGPTGVGKTAAVYACAQELGFKIFEVNASSQRSGRQI 1167
Cdd:PRK04195   45 YGPPGVGKTSLAHALANDYGWEVIELNASDQRTADVI 81
rad24 TIGR00602
checkpoint protein rad24; All proteins in this family for which functions are known are ...
1005-1163 4.64e-05

checkpoint protein rad24; All proteins in this family for which functions are known are involved in DNA damage tolerance (likely cell cycle checkpoints).This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair].


Pssm-ID: 129690 [Multi-domain]  Cd Length: 637  Bit Score: 46.87  E-value: 4.64e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439460  1005 NSKSKRKKpneYSKNLEKTNRKSEELSKRNNSsGIKLDSSKDSGTEdmLWTEKYQPQTASELIGNELAIKKLHSWLKdwk 1084
Cdd:TIGR00602   31 PTSSHRRK---NSPSTDIHARKRGFLSLEQDT-GLELSSENLDGNE--PWVEKYKPETQHELAVHKKKIEEVETWLK--- 101
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439460  1085 rrAELEERQNLKgkrdekhedfsggidfkgssddeeesrlcnTVLITGPTGVGKTAAVYACAQELGFKIFE-VNASSQRS 1163
Cdd:TIGR00602  102 --AQVLENAPKR------------------------------ILLITGPSGCGKSTTIKILSKELGIQVQEwSNPTLPDF 149
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
1126-1164 1.17e-03

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 40.05  E-value: 1.17e-03
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|..
gi 296439460   1126 NTVLITGPTGVGKTAAVYACAQEL---GFKIFEVNASSQRSG 1164
Cdd:smart00382    3 EVILIVGPPGSGKTTLARALARELgppGGGVIYIDGEDILEE 44
 
Name Accession Description Interval E-value
AAA cd00009
The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily ...
1126-1160 3.35e-05

The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.


Pssm-ID: 99707  Cd Length: 151  Bit Score: 44.44  E-value: 3.35e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 296439460 1126 NTVLITGPTGVGKTAAVYACAQEL---GFKIFEVNASS 1160
Cdd:cd00009    20 KNLLLYGPPGTGKTTLARAIANELfrpGAPFLYLNASD 57
AAA pfam00004
ATPase family associated with various cellular activities (AAA); AAA family proteins often ...
1128-1173 1.41e-06

ATPase family associated with various cellular activities (AAA); AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes.


Pssm-ID: 249500  Cd Length: 131  Bit Score: 48.75  E-value: 1.41e-06
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 296439460  1128 VLITGPTGVGKTAAVYACAQELGFKIFEVNASSQRSG---------RQILSQLKE 1173
Cdd:pfam00004    1 LLLYGPPGTGKTTLAKAVAKELGAPFIEISGSELVSKyvgesekrlRELFEAAKK 55
PRK04195 PRK04195
replication factor C large subunit; Provisional
1051-1167 1.55e-14

replication factor C large subunit; Provisional


Pssm-ID: 235250 [Multi-domain]  Cd Length: 482  Bit Score: 77.27  E-value: 1.55e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439460 1051 DMLWTEKYQPQTASELIGNELAIKKLHSWLKDWKRraeleerqnlkgkrdekhedfsgGIDFKgssddeeesrlcnTVLI 1130
Cdd:PRK04195    1 MMPWVEKYRPKTLSDVVGNEKAKEQLREWIESWLK-----------------------GKPKK-------------ALLL 44
                          90       100       110
                  ....*....|....*....|....*....|....*..
gi 296439460 1131 TGPTGVGKTAAVYACAQELGFKIFEVNASSQRSGRQI 1167
Cdd:PRK04195   45 YGPPGVGKTSLAHALANDYGWEVIELNASDQRTADVI 81
PRK12402 PRK12402
replication factor C small subunit 2; Reviewed
1052-1149 1.38e-05

replication factor C small subunit 2; Reviewed


Pssm-ID: 237090 [Multi-domain]  Cd Length: 337  Bit Score: 48.06  E-value: 1.38e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439460 1052 MLWTEKYQPQTASELIGNELAIKKLhswlkdwKRRAELEERQNLkgkrdekhedfsggidfkgssddeeesrlcntvLIT 1131
Cdd:PRK12402    3 PLWTEKYRPALLEDILGQDEVVERL-------SRAVDSPNLPHL---------------------------------LVQ 42
                          90
                  ....*....|....*...
gi 296439460 1132 GPTGVGKTAAVYACAQEL 1149
Cdd:PRK12402   43 GPPGSGKTAAVRALAREL 60
rad24 TIGR00602
checkpoint protein rad24; All proteins in this family for which functions are known are ...
1005-1163 4.64e-05

checkpoint protein rad24; All proteins in this family for which functions are known are involved in DNA damage tolerance (likely cell cycle checkpoints).This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair].


Pssm-ID: 129690 [Multi-domain]  Cd Length: 637  Bit Score: 46.87  E-value: 4.64e-05
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439460  1005 NSKSKRKKpneYSKNLEKTNRKSEELSKRNNSsGIKLDSSKDSGTEdmLWTEKYQPQTASELIGNELAIKKLHSWLKdwk 1084
Cdd:TIGR00602   31 PTSSHRRK---NSPSTDIHARKRGFLSLEQDT-GLELSSENLDGNE--PWVEKYKPETQHELAVHKKKIEEVETWLK--- 101
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 296439460  1085 rrAELEERQNLKgkrdekhedfsggidfkgssddeeesrlcnTVLITGPTGVGKTAAVYACAQELGFKIFE-VNASSQRS 1163
Cdd:TIGR00602  102 --AQVLENAPKR------------------------------ILLITGPSGCGKSTTIKILSKELGIQVQEwSNPTLPDF 149
AAA smart00382
ATPases associated with a variety of cellular activities; AAA - ATPases associated with a ...
1126-1164 1.17e-03

ATPases associated with a variety of cellular activities; AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.


Pssm-ID: 214640 [Multi-domain]  Cd Length: 148  Bit Score: 40.05  E-value: 1.17e-03
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|..
gi 296439460   1126 NTVLITGPTGVGKTAAVYACAQEL---GFKIFEVNASSQRSG 1164
Cdd:smart00382    3 EVILIVGPPGSGKTTLARALARELgppGGGVIYIDGEDILEE 44
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH