NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|291391360|ref|XP_002712461|]
View 

PREDICTED: TFIIH basal transcription factor complex helicase XPB subunit [Oryctolagus cuniculus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ERCC3_RAD25_C pfam16203
ERCC3/RAD25/XPB C-terminal helicase; This is the C-terminal helicase domain of ERCC3, RAD25 ...
496-739 0e+00

ERCC3/RAD25/XPB C-terminal helicase; This is the C-terminal helicase domain of ERCC3, RAD25 and XPB helicases.


:

Pssm-ID: 292820  Cd Length: 244  Bit Score: 520.63  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  496 LENNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRL 575
Cdd:pfam16203   1 LQNKGHIARVQCAEVWCPMTPEFYREYLRSKSRKKRLLYVMNPNKFRACQFLIRYHERRGDKIIVFSDNVFALKEYAKKL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  576 NKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGmVAEEY 655
Cdd:pfam16203  81 GKPYIYGGTSQAERMRILQNFQHNPKVNTIFLSKVGDTSIDLPEANVLIQISSHFGSRRQEAQRLGRILRAKRR-NDEGF 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  656 NAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEE-LAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFG 734
Cdd:pfam16203 160 NAFFYSLVSKDTQEMYYSTKRQQFLVDQGYAFKVITNLAGMEDEEnLAYSTKEEQLELLQKVLAANDEDAEEEVIPDDLG 239

                  ....*
gi 291391360  735 SKSSQ 739
Cdd:pfam16203 240 SLKSG 244
Helicase_C_3 pfam13625
Helicase conserved C-terminal domain; This domain family is found in a wide variety of ...
76-198 1.80e-56

Helicase conserved C-terminal domain; This domain family is found in a wide variety of helicases and helicase-related proteins.


:

Pssm-ID: 290354  Cd Length: 123  Bit Score: 189.63  E-value: 1.80e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360   76 LWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQF 155
Cdd:pfam13625   1 LIVQPDLTILLEGFSPLAPQARDFLAAFAELESRPGHAHTYRLTPLSLRRALSAGLTAEDIIDFLERLSKTPVPQSLLYL 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 291391360  156 IKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECR 198
Cdd:pfam13625  81 IRDVARRYGKVRLVLKEARYYLESDDPALLQELLADPAIAKLR 123
ResIII pfam04851
Type III restriction enzyme, res subunit;
315-472 9.53e-15

Type III restriction enzyme, res subunit;


:

Pssm-ID: 282678  Cd Length: 162  Bit Score: 72.71  E-value: 9.53e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  315 VLRPYQE---KSLRKMFGNGRARsGVIVLPCGAGKSLVGVTAACTVRK-----RCLVLGNSAVSVEQWKAQFKMWsTIDD 386
Cdd:pfam04851   3 KLRPYQIeaiERLLESIKKGEKR-GLIVMATGSGKTLTAAALIARLSKkgpikKVLFLVPRKDLLEQALEEFKKF-LPNY 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  387 SQICRFTSDAKDKPI--GCSVAISTYSMLGHttkrswEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKL 464
Cdd:pfam04851  81 VEIGEILSGDKKDIEvdDKKIVVTTIQSLYK------ALELESLELLPDFFDVIIIDEAHRSSAKSYRNILEYFKPAFLL 154

                  ....*...
gi 291391360  465 GLTATLVR 472
Cdd:pfam04851 155 GLTATPER 162
rad25 TIGR00603
DNA repair helicase rad25; All proteins in this family for which functions are known are ...
60-779 0e+00

DNA repair helicase rad25; All proteins in this family for which functions are known are DNA-DNA helicases used for the initiation of nucleotide excision repair and transacription as part of the TFIIH complex.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


:

Pssm-ID: 273168 [Multi-domain]  Cd Length: 732  Bit Score: 1379.12  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360   60 DYRLQMPLKDDHASRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEY 139
Cdd:TIGR00603   1 DYSKQLELKPDHGSRPLWVAPDGHIFLESFSPLYKQAQDFLVAIAEPVCRPEHIHEYKLTAYSLYAAVSVGLETEDIIEV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  140 LRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECRLRNSEGEatELITETFTSKSA 219
Cdd:TIGR00603  81 LGRLSKTPIPKGIIEFIRLCTQSYGKVKLVLKHNRYFVESPHPEVLQRLLKDPVIAPCRIDPTEEE--SLQTPTYGSKED 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  220 ISKTVEGG-GGPSTSRVTDPQGKSDIPTDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFR 298
Cdd:TIGR00603 159 FIINKPGFtGGASAGQLEANQGESAVPKDIADFYELEEEEEDEDEETATHSFEIDQEQVEEVKKRCIELDYPLLEEYDFR 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  299 NDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQF 378
Cdd:TIGR00603 239 NDTVNPDLNIDLKPTTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVTAACTVKKSCLVLCTSAVSVEQWKQQF 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  379 KMWSTIDDSQICRFTSDAKDKPIG-CSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTI 457
Cdd:TIGR00603 319 KMWSTIDDSQICRFTSDAKERFHGeAGVVVSTYSMVAHTGKRSYESEKVMEWLTNREWGLILLDEVHVVPAAMFRRVLTI 398
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  458 VQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELENNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMN 537
Cdd:TIGR00603 399 VQAHCKLGLTATLVREDDKITDLNFLIGPKLYEANWMELQKKGFIANVQCAEVWCPMTPEFYREYLRENSRKRMLLYVMN 478
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  538 PNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDL 617
Cdd:TIGR00603 479 PNKFRACQFLIRFHEQRGDKIIVFSDNVFALKEYAIKLGKPFIYGPTSQQERMQILQNFQHNPKVNTIFLSKVGDTSIDL 558
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  618 PEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGME 697
Cdd:TIGR00603 559 PEANVLIQISSHYGSRRQEAQRLGRILRAKKGSDAEEYNAFFYSLVSKDTQEMYYSTKRQRFLVDQGYSFKVITHLPGMD 638
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  698 EE-ELAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGS-----------KSSQASRRFGTMSSMSGADDTVYMEYHSSR 765
Cdd:TIGR00603 639 NEsNLAYSSKEEQLELLQKVLLAGDLDAELEVLEGEFGSralgasrsmssASGKAVRRGGSLSSLSGGDDMAYMEYRKPA 718
                         730
                  ....*....|....
gi 291391360  766 SKATTKHVHPLFKR 779
Cdd:TIGR00603 719 IKKSKKEVHPLFKK 732
 
Name Accession Description Interval E-value
ERCC3_RAD25_C pfam16203
ERCC3/RAD25/XPB C-terminal helicase; This is the C-terminal helicase domain of ERCC3, RAD25 ...
496-739 0e+00

ERCC3/RAD25/XPB C-terminal helicase; This is the C-terminal helicase domain of ERCC3, RAD25 and XPB helicases.


Pssm-ID: 292820  Cd Length: 244  Bit Score: 520.63  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  496 LENNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRL 575
Cdd:pfam16203   1 LQNKGHIARVQCAEVWCPMTPEFYREYLRSKSRKKRLLYVMNPNKFRACQFLIRYHERRGDKIIVFSDNVFALKEYAKKL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  576 NKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGmVAEEY 655
Cdd:pfam16203  81 GKPYIYGGTSQAERMRILQNFQHNPKVNTIFLSKVGDTSIDLPEANVLIQISSHFGSRRQEAQRLGRILRAKRR-NDEGF 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  656 NAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEE-LAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFG 734
Cdd:pfam16203 160 NAFFYSLVSKDTQEMYYSTKRQQFLVDQGYAFKVITNLAGMEDEEnLAYSTKEEQLELLQKVLAANDEDAEEEVIPDDLG 239

                  ....*
gi 291391360  735 SKSSQ 739
Cdd:pfam16203 240 SLKSG 244
Helicase_C_3 pfam13625
Helicase conserved C-terminal domain; This domain family is found in a wide variety of ...
76-198 1.80e-56

Helicase conserved C-terminal domain; This domain family is found in a wide variety of helicases and helicase-related proteins.


Pssm-ID: 290354  Cd Length: 123  Bit Score: 189.63  E-value: 1.80e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360   76 LWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQF 155
Cdd:pfam13625   1 LIVQPDLTILLEGFSPLAPQARDFLAAFAELESRPGHAHTYRLTPLSLRRALSAGLTAEDIIDFLERLSKTPVPQSLLYL 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 291391360  156 IKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECR 198
Cdd:pfam13625  81 IRDVARRYGKVRLVLKEARYYLESDDPALLQELLADPAIAKLR 123
ResIII pfam04851
Type III restriction enzyme, res subunit;
315-472 9.53e-15

Type III restriction enzyme, res subunit;


Pssm-ID: 282678  Cd Length: 162  Bit Score: 72.71  E-value: 9.53e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  315 VLRPYQE---KSLRKMFGNGRARsGVIVLPCGAGKSLVGVTAACTVRK-----RCLVLGNSAVSVEQWKAQFKMWsTIDD 386
Cdd:pfam04851   3 KLRPYQIeaiERLLESIKKGEKR-GLIVMATGSGKTLTAAALIARLSKkgpikKVLFLVPRKDLLEQALEEFKKF-LPNY 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  387 SQICRFTSDAKDKPI--GCSVAISTYSMLGHttkrswEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKL 464
Cdd:pfam04851  81 VEIGEILSGDKKDIEvdDKKIVVTTIQSLYK------ALELESLELLPDFFDVIIIDEAHRSSAKSYRNILEYFKPAFLL 154

                  ....*...
gi 291391360  465 GLTATLVR 472
Cdd:pfam04851 155 GLTATPER 162
HELICc smart00490
helicase superfamily c-terminal domain;
579-647 2.90e-10

helicase superfamily c-terminal domain;


Pssm-ID: 197757  Cd Length: 82  Bit Score: 57.99  E-value: 2.90e-10
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 291391360   579 YIYGPTSQGERMQILQNFKhNPKINTIFISKVGDTSFDLPEANVLIQISSHgGSRRQEAQRLGRVLRAK 647
Cdd:smart00490  16 RLHGGLSQEEREEILDKFN-NGKIKVLVATDVAERGLDLPGVDLVIIYDLP-WSPASYIQRIGRAGRAG 82
HELICc cd00079
Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, ...
537-646 8.32e-10

Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process


Pssm-ID: 238034 [Multi-domain]  Cd Length: 131  Bit Score: 57.25  E-value: 8.32e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 537 NPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKP-----YIYGPTSQGERMQILQNFKHNpKINTIFISKVG 611
Cdd:cd00079   10 EDEKLEALLELLKEHLKKGGKVLIFCPSKKMLDELAELLRKPgikvaALHGDGSQEEREEVLKDFREG-EIVVLVATDVI 88
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 291391360 612 DTSFDLPEANVLIQISSHGGSrRQEAQRLGRVLRA 646
Cdd:cd00079   89 ARGIDLPNVSVVINYDLPWSP-SSYLQRIGRAGRA 122
DEXDc cd00046
DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or ...
334-470 5.70e-07

DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.


Pssm-ID: 238005  Cd Length: 144  Bit Score: 48.87  E-value: 5.70e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 334 RSGVIVLPCGAGKSLVGVTAACTV-----RKRCLVLGNSAVSVEQWKAQFKMWSTIDDS--QICRFTSDAKDKPI---GC 403
Cdd:cd00046    1 RDVLLAAPTGSGKTLAALLPILELldslkGGQVLVLAPTRELANQVAERLKELFGEGIKvgYLIGGTSIKQQEKLlsgKT 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 291391360 404 SVAISTYSMLGHTTKRsweaervmEWLKTQEWGLMILDEVHTIPAKMF-----RRVLTIVQAHCKLGLTATL 470
Cdd:cd00046   81 DIVVGTPGRLLDELER--------LKLSLKKLDLLILDEAHRLLNQGFgllglKILLKLPKDRQVLLLSATP 144
rad25 TIGR00603
DNA repair helicase rad25; All proteins in this family for which functions are known are ...
60-779 0e+00

DNA repair helicase rad25; All proteins in this family for which functions are known are DNA-DNA helicases used for the initiation of nucleotide excision repair and transacription as part of the TFIIH complex.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273168 [Multi-domain]  Cd Length: 732  Bit Score: 1379.12  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360   60 DYRLQMPLKDDHASRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEY 139
Cdd:TIGR00603   1 DYSKQLELKPDHGSRPLWVAPDGHIFLESFSPLYKQAQDFLVAIAEPVCRPEHIHEYKLTAYSLYAAVSVGLETEDIIEV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  140 LRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECRLRNSEGEatELITETFTSKSA 219
Cdd:TIGR00603  81 LGRLSKTPIPKGIIEFIRLCTQSYGKVKLVLKHNRYFVESPHPEVLQRLLKDPVIAPCRIDPTEEE--SLQTPTYGSKED 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  220 ISKTVEGG-GGPSTSRVTDPQGKSDIPTDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFR 298
Cdd:TIGR00603 159 FIINKPGFtGGASAGQLEANQGESAVPKDIADFYELEEEEEDEDEETATHSFEIDQEQVEEVKKRCIELDYPLLEEYDFR 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  299 NDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQF 378
Cdd:TIGR00603 239 NDTVNPDLNIDLKPTTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVTAACTVKKSCLVLCTSAVSVEQWKQQF 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  379 KMWSTIDDSQICRFTSDAKDKPIG-CSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTI 457
Cdd:TIGR00603 319 KMWSTIDDSQICRFTSDAKERFHGeAGVVVSTYSMVAHTGKRSYESEKVMEWLTNREWGLILLDEVHVVPAAMFRRVLTI 398
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  458 VQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELENNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMN 537
Cdd:TIGR00603 399 VQAHCKLGLTATLVREDDKITDLNFLIGPKLYEANWMELQKKGFIANVQCAEVWCPMTPEFYREYLRENSRKRMLLYVMN 478
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  538 PNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDL 617
Cdd:TIGR00603 479 PNKFRACQFLIRFHEQRGDKIIVFSDNVFALKEYAIKLGKPFIYGPTSQQERMQILQNFQHNPKVNTIFLSKVGDTSIDL 558
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  618 PEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGME 697
Cdd:TIGR00603 559 PEANVLIQISSHYGSRRQEAQRLGRILRAKKGSDAEEYNAFFYSLVSKDTQEMYYSTKRQRFLVDQGYSFKVITHLPGMD 638
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  698 EE-ELAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGS-----------KSSQASRRFGTMSSMSGADDTVYMEYHSSR 765
Cdd:TIGR00603 639 NEsNLAYSSKEEQLELLQKVLLAGDLDAELEVLEGEFGSralgasrsmssASGKAVRRGGSLSSLSGGDDMAYMEYRKPA 718
                         730
                  ....*....|....
gi 291391360  766 SKATTKHVHPLFKR 779
Cdd:TIGR00603 719 IKKSKKEVHPLFKK 732
SSL2 COG1061
Superfamily II DNA or RNA helicase [Transcription, Replication, recombination and repair];
294-700 2.99e-96

Superfamily II DNA or RNA helicase [Transcription, Replication, recombination and repair];


Pssm-ID: 223989 [Multi-domain]  Cd Length: 442  Bit Score: 308.98  E-value: 2.99e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 294 EYDFRNDSVNPdINIDLKPTAVLRPYQEKSLRKMFGNGRA-RSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVE 372
Cdd:COG1061   16 LADYVLDEGLP-LKLIVAFEFELRPYQEEALDALVKNRRTeRRGVIVLPTGAGKTVVAAEAIAELKRSTLVLVPTKELLD 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 373 QWKAQFKMWsTIDDSQICRFTSDAKDkPIGCSVAISTYSMLghtTKRSWEAERVMEwlktqEWGLMILDEVHTIPAKMFR 452
Cdd:COG1061   95 QWAEALKKF-LLLNDEIGIYGGGEKE-LEPAKVTVATVQTL---ARRQLLDEFLGN-----EFGLIIFDEVHHLPAPSYR 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 453 RVLTIVQAHCK-LGLTATLVREDD-KIVDLNFLIGPKLYEANWMELENNGYIAKVQCAEVWCPMSPEFYREY-------- 522
Cdd:COG1061  165 RILELLSAAYPrLGLTATPEREDGgRIGDLFDLIGPIVYEVSLKELIDEGYLAPYKYVEIKVTLTEDEEREYakesarfr 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 523 -------VAIKTKKRILLYTMNPNKFRACQFLIKFHErRNDKIIVFADNVFALKEYAIRLNKP----YIYGPTSQGERMQ 591
Cdd:COG1061  245 ellrargTLRAENEARRIAIASERKIAAVRGLLLKHA-RGDKTLIFASDVEHAYEIAKLFLAPgiveAITGETPKEEREA 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 592 ILQNFKHNpKINTIFISKVGDTSFDLPEANVLIQISShGGSRRQEAQRLGRVLRAKKGmvAEEYNAFFYSLVSQDTQEMA 671
Cdd:COG1061  324 ILERFRTG-GIKVLVTVKVLDEGVDIPDADVLIILRP-TGSRRLFIQRLGRGLRPAEG--KEDTLALDYSLVPDDLGEED 399
                        410       420
                 ....*....|....*....|....*....
gi 291391360 672 YSTKRQRFLVDQGYSFKVITKLAGMEEEE 700
Cdd:COG1061  400 IARRRRLFLIRKGYTYRLLTADEEGELIP 428
DEXDc smart00487
DEAD-like helicases superfamily;
308-482 2.69e-17

DEAD-like helicases superfamily;


Pssm-ID: 214692 [Multi-domain]  Cd Length: 201  Bit Score: 81.00  E-value: 2.69e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360   308 IDLKPTAVLRPYQEKSLRKMFGNGRarSGVIVLPCGAGKSLVGVTAA-----CTVRKRCLVLGNSAVSVEQWKAQFKMWS 382
Cdd:smart00487   1 IEKFGFEPLRPYQKEAIEALLSGLR--DVILAAPTGSGKTLAALLPAlealkRGKGGRVLVLVPTRELAEQWAEELKKLG 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360   383 T-IDDSQICRFTSDAKDKPI------GCSVAISTYSMLGHTTKRsweaervmEWLKTQEWGLMILDEVHTIPAKMFRRVL 455
Cdd:smart00487  79 PsLGLKVVGLYGGDSKREQLrklesgKTDILVTTPGRLLDLLEN--------DKLSLSNVDLVILDEAHRLLDGGFGDQL 150
                          170       180       190
                   ....*....|....*....|....*....|..
gi 291391360   456 TIV-----QAHCKLGLTATLVREDDKIVDLNF 482
Cdd:smart00487 151 EKLlkllpKNVQLLLLSATPPEEIENLLELFL 182
uvsW PHA02558
UvsW helicase; Provisional
317-571 1.43e-03

UvsW helicase; Provisional


Pssm-ID: 222875 [Multi-domain]  Cd Length: 501  Bit Score: 40.38  E-value: 1.43e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 317 RPYQEKSLRKMFGNGRarsGVIVLPCGAGKSLVgvtAACTVR-------KRCLVLGNSAVSVEQWKAQFKMWSTIDDS-- 387
Cdd:PHA02558 116 HWYQYDAVYEGLKNNR---RLLNLPTSAGKSLI---QYLLSRyylenyeGKVLIIVPTTSLVTQMIDDFVDYRLFPREam 189
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 388 -QICRFTSDAKDKPIgcsvAISTYSMLGHTTKrsweaervmEWLktQEWGLMILDEVHTIPAKMFRRVLTIVqAHC--KL 464
Cdd:PHA02558 190 hKIYSGTAKDTDAPI----VVSTWQSAVKQPK---------EWF--DQFGMVIVDECHLFTGKSLTSIITKL-DNCkfKF 253
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 465 GLTATLVREDDKIVDLNFLIGP--KLYEANwmELENNGYIAKVQCAEVWCPMSPEFyreyvaiktkkRILLytmnpnKFR 542
Cdd:PHA02558 254 GLTGSLRDGKANILQYVGLFGDifKPVTTS--QLMEEGQVTDLKINSIFLRYPDED-----------RVKL------KGE 314
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 291391360 543 ACQFLIKF---HERRNDKIIVFA-------DNVFALKEY 571
Cdd:PHA02558 315 DYQEEIKYitsHTKRNKWIANLAlklakkgENTFVMFKY 353
 
Name Accession Description Interval E-value
ERCC3_RAD25_C pfam16203
ERCC3/RAD25/XPB C-terminal helicase; This is the C-terminal helicase domain of ERCC3, RAD25 ...
496-739 0e+00

ERCC3/RAD25/XPB C-terminal helicase; This is the C-terminal helicase domain of ERCC3, RAD25 and XPB helicases.


Pssm-ID: 292820  Cd Length: 244  Bit Score: 520.63  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  496 LENNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRL 575
Cdd:pfam16203   1 LQNKGHIARVQCAEVWCPMTPEFYREYLRSKSRKKRLLYVMNPNKFRACQFLIRYHERRGDKIIVFSDNVFALKEYAKKL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  576 NKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGmVAEEY 655
Cdd:pfam16203  81 GKPYIYGGTSQAERMRILQNFQHNPKVNTIFLSKVGDTSIDLPEANVLIQISSHFGSRRQEAQRLGRILRAKRR-NDEGF 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  656 NAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEE-LAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFG 734
Cdd:pfam16203 160 NAFFYSLVSKDTQEMYYSTKRQQFLVDQGYAFKVITNLAGMEDEEnLAYSTKEEQLELLQKVLAANDEDAEEEVIPDDLG 239

                  ....*
gi 291391360  735 SKSSQ 739
Cdd:pfam16203 240 SLKSG 244
Helicase_C_3 pfam13625
Helicase conserved C-terminal domain; This domain family is found in a wide variety of ...
76-198 1.80e-56

Helicase conserved C-terminal domain; This domain family is found in a wide variety of helicases and helicase-related proteins.


Pssm-ID: 290354  Cd Length: 123  Bit Score: 189.63  E-value: 1.80e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360   76 LWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQF 155
Cdd:pfam13625   1 LIVQPDLTILLEGFSPLAPQARDFLAAFAELESRPGHAHTYRLTPLSLRRALSAGLTAEDIIDFLERLSKTPVPQSLLYL 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 291391360  156 IKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECR 198
Cdd:pfam13625  81 IRDVARRYGKVRLVLKEARYYLESDDPALLQELLADPAIAKLR 123
ResIII pfam04851
Type III restriction enzyme, res subunit;
315-472 9.53e-15

Type III restriction enzyme, res subunit;


Pssm-ID: 282678  Cd Length: 162  Bit Score: 72.71  E-value: 9.53e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  315 VLRPYQE---KSLRKMFGNGRARsGVIVLPCGAGKSLVGVTAACTVRK-----RCLVLGNSAVSVEQWKAQFKMWsTIDD 386
Cdd:pfam04851   3 KLRPYQIeaiERLLESIKKGEKR-GLIVMATGSGKTLTAAALIARLSKkgpikKVLFLVPRKDLLEQALEEFKKF-LPNY 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  387 SQICRFTSDAKDKPI--GCSVAISTYSMLGHttkrswEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKL 464
Cdd:pfam04851  81 VEIGEILSGDKKDIEvdDKKIVVTTIQSLYK------ALELESLELLPDFFDVIIIDEAHRSSAKSYRNILEYFKPAFLL 154

                  ....*...
gi 291391360  465 GLTATLVR 472
Cdd:pfam04851 155 GLTATPER 162
Helicase_C pfam00271
Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, ...
540-647 4.91e-11

Helicase conserved C-terminal domain; The Prosite family is restricted to DEAD/H helicases, whereas this domain family is found in a wide variety of helicases and helicase related proteins. It may be that this is not an autonomously folding unit, but an integral part of the helicase.


Pssm-ID: 278689  Cd Length: 111  Bit Score: 60.71  E-value: 4.91e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  540 KFRACQFLIKfhERRNDKIIVFADNVFALKEYAIRLNKP-----YIYGPTSQGERMQILQNFKhnPKINTIFIS-KVGDT 613
Cdd:pfam00271   3 KLEALLELLK--KLLKEKVLIFSQTKKEADILAELLRERgikvaRLHGDMSQEEREEILEDFR--KGKIKVLVAtDVAGR 78
                          90       100       110
                  ....*....|....*....|....*....|....
gi 291391360  614 SFDLPEANVLIQISSHgGSRRQEAQRLGRVLRAK 647
Cdd:pfam00271  79 GLDLPDVDLVIIYDPP-WNPASYIQRIGRAGRAG 111
HELICc smart00490
helicase superfamily c-terminal domain;
579-647 2.90e-10

helicase superfamily c-terminal domain;


Pssm-ID: 197757  Cd Length: 82  Bit Score: 57.99  E-value: 2.90e-10
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 291391360   579 YIYGPTSQGERMQILQNFKhNPKINTIFISKVGDTSFDLPEANVLIQISSHgGSRRQEAQRLGRVLRAK 647
Cdd:smart00490  16 RLHGGLSQEEREEILDKFN-NGKIKVLVATDVAERGLDLPGVDLVIIYDLP-WSPASYIQRIGRAGRAG 82
HELICc cd00079
Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, ...
537-646 8.32e-10

Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process


Pssm-ID: 238034 [Multi-domain]  Cd Length: 131  Bit Score: 57.25  E-value: 8.32e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 537 NPNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKP-----YIYGPTSQGERMQILQNFKHNpKINTIFISKVG 611
Cdd:cd00079   10 EDEKLEALLELLKEHLKKGGKVLIFCPSKKMLDELAELLRKPgikvaALHGDGSQEEREEVLKDFREG-EIVVLVATDVI 88
                         90       100       110
                 ....*....|....*....|....*....|....*
gi 291391360 612 DTSFDLPEANVLIQISSHGGSrRQEAQRLGRVLRA 646
Cdd:cd00079   89 ARGIDLPNVSVVINYDLPWSP-SSYLQRIGRAGRA 122
DEXDc cd00046
DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or ...
334-470 5.70e-07

DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region.


Pssm-ID: 238005  Cd Length: 144  Bit Score: 48.87  E-value: 5.70e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 334 RSGVIVLPCGAGKSLVGVTAACTV-----RKRCLVLGNSAVSVEQWKAQFKMWSTIDDS--QICRFTSDAKDKPI---GC 403
Cdd:cd00046    1 RDVLLAAPTGSGKTLAALLPILELldslkGGQVLVLAPTRELANQVAERLKELFGEGIKvgYLIGGTSIKQQEKLlsgKT 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 291391360 404 SVAISTYSMLGHTTKRsweaervmEWLKTQEWGLMILDEVHTIPAKMF-----RRVLTIVQAHCKLGLTATL 470
Cdd:cd00046   81 DIVVGTPGRLLDELER--------LKLSLKKLDLLILDEAHRLLNQGFgllglKILLKLPKDRQVLLLSATP 144
DEAD pfam00270
DEAD/DEAH box helicase; Members of this family include the DEAD and DEAH box helicases. ...
317-473 6.73e-03

DEAD/DEAH box helicase; Members of this family include the DEAD and DEAH box helicases. Helicases are involved in unwinding nucleic acids. The DEAD box helicases are involved in various aspects of RNA metabolizm, including nuclear transcription, pre mRNA splicing, ribosome biogenesis, nucleocytoplasmic transport, translation, RNA decay and organellar gene expression.


Pssm-ID: 278688  Cd Length: 164  Bit Score: 36.83  E-value: 6.73e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  317 RPYQEKSLRKMFGNgraRSGVIVLPCGAGKSLVGVTAACTV-----RKRCLVLGNSAVSVEQWKAQFKMWSTIDDSQICR 391
Cdd:pfam00270   1 TPIQAEAIPAILEG---KDVLVQAPTGSGKTLAFLLPALEAldldnGPQALVLAPTRELAEQIYEELKKLGKGLGLKVAS 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  392 FTSDAKDKPI-----GCSVAISTYSMLGHTTKRSWEAERVmewlktqewGLMILDEVHTIPAKMFR----RVLTIVQAHC 462
Cdd:pfam00270  78 LLGGDSRKEQleklkGPDILVGTPGRLLDLLQERKLLKNL---------KLLVLDEAHRLLDMGFGpdleEILRRLPKKR 148
                         170
                  ....*....|..
gi 291391360  463 K-LGLTATLVRE 473
Cdd:pfam00270 149 QiLLLSATLPRN 160
rad25 TIGR00603
DNA repair helicase rad25; All proteins in this family for which functions are known are ...
60-779 0e+00

DNA repair helicase rad25; All proteins in this family for which functions are known are DNA-DNA helicases used for the initiation of nucleotide excision repair and transacription as part of the TFIIH complex.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273168 [Multi-domain]  Cd Length: 732  Bit Score: 1379.12  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360   60 DYRLQMPLKDDHASRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVSVGLQTSDITEY 139
Cdd:TIGR00603   1 DYSKQLELKPDHGSRPLWVAPDGHIFLESFSPLYKQAQDFLVAIAEPVCRPEHIHEYKLTAYSLYAAVSVGLETEDIIEV 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  140 LRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESSHPDVIQHLLQDPVIRECRLRNSEGEatELITETFTSKSA 219
Cdd:TIGR00603  81 LGRLSKTPIPKGIIEFIRLCTQSYGKVKLVLKHNRYFVESPHPEVLQRLLKDPVIAPCRIDPTEEE--SLQTPTYGSKED 158
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  220 ISKTVEGG-GGPSTSRVTDPQGKSDIPTDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFR 298
Cdd:TIGR00603 159 FIINKPGFtGGASAGQLEANQGESAVPKDIADFYELEEEEEDEDEETATHSFEIDQEQVEEVKKRCIELDYPLLEEYDFR 238
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  299 NDSVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVEQWKAQF 378
Cdd:TIGR00603 239 NDTVNPDLNIDLKPTTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKSLVGVTAACTVKKSCLVLCTSAVSVEQWKQQF 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  379 KMWSTIDDSQICRFTSDAKDKPIG-CSVAISTYSMLGHTTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTI 457
Cdd:TIGR00603 319 KMWSTIDDSQICRFTSDAKERFHGeAGVVVSTYSMVAHTGKRSYESEKVMEWLTNREWGLILLDEVHVVPAAMFRRVLTI 398
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  458 VQAHCKLGLTATLVREDDKIVDLNFLIGPKLYEANWMELENNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMN 537
Cdd:TIGR00603 399 VQAHCKLGLTATLVREDDKITDLNFLIGPKLYEANWMELQKKGFIANVQCAEVWCPMTPEFYREYLRENSRKRMLLYVMN 478
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  538 PNKFRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNPKINTIFISKVGDTSFDL 617
Cdd:TIGR00603 479 PNKFRACQFLIRFHEQRGDKIIVFSDNVFALKEYAIKLGKPFIYGPTSQQERMQILQNFQHNPKVNTIFLSKVGDTSIDL 558
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  618 PEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFYSLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGME 697
Cdd:TIGR00603 559 PEANVLIQISSHYGSRRQEAQRLGRILRAKKGSDAEEYNAFFYSLVSKDTQEMYYSTKRQRFLVDQGYSFKVITHLPGMD 638
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360  698 EE-ELAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGS-----------KSSQASRRFGTMSSMSGADDTVYMEYHSSR 765
Cdd:TIGR00603 639 NEsNLAYSSKEEQLELLQKVLLAGDLDAELEVLEGEFGSralgasrsmssASGKAVRRGGSLSSLSGGDDMAYMEYRKPA 718
                         730
                  ....*....|....
gi 291391360  766 SKATTKHVHPLFKR 779
Cdd:TIGR00603 719 IKKSKKEVHPLFKK 732
SSL2 COG1061
Superfamily II DNA or RNA helicase [Transcription, Replication, recombination and repair];
294-700 2.99e-96

Superfamily II DNA or RNA helicase [Transcription, Replication, recombination and repair];


Pssm-ID: 223989 [Multi-domain]  Cd Length: 442  Bit Score: 308.98  E-value: 2.99e-96
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 294 EYDFRNDSVNPdINIDLKPTAVLRPYQEKSLRKMFGNGRA-RSGVIVLPCGAGKSLVGVTAACTVRKRCLVLGNSAVSVE 372
Cdd:COG1061   16 LADYVLDEGLP-LKLIVAFEFELRPYQEEALDALVKNRRTeRRGVIVLPTGAGKTVVAAEAIAELKRSTLVLVPTKELLD 94
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 373 QWKAQFKMWsTIDDSQICRFTSDAKDkPIGCSVAISTYSMLghtTKRSWEAERVMEwlktqEWGLMILDEVHTIPAKMFR 452
Cdd:COG1061   95 QWAEALKKF-LLLNDEIGIYGGGEKE-LEPAKVTVATVQTL---ARRQLLDEFLGN-----EFGLIIFDEVHHLPAPSYR 164
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 453 RVLTIVQAHCK-LGLTATLVREDD-KIVDLNFLIGPKLYEANWMELENNGYIAKVQCAEVWCPMSPEFYREY-------- 522
Cdd:COG1061  165 RILELLSAAYPrLGLTATPEREDGgRIGDLFDLIGPIVYEVSLKELIDEGYLAPYKYVEIKVTLTEDEEREYakesarfr 244
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 523 -------VAIKTKKRILLYTMNPNKFRACQFLIKFHErRNDKIIVFADNVFALKEYAIRLNKP----YIYGPTSQGERMQ 591
Cdd:COG1061  245 ellrargTLRAENEARRIAIASERKIAAVRGLLLKHA-RGDKTLIFASDVEHAYEIAKLFLAPgiveAITGETPKEEREA 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 592 ILQNFKHNpKINTIFISKVGDTSFDLPEANVLIQISShGGSRRQEAQRLGRVLRAKKGmvAEEYNAFFYSLVSQDTQEMA 671
Cdd:COG1061  324 ILERFRTG-GIKVLVTVKVLDEGVDIPDADVLIILRP-TGSRRLFIQRLGRGLRPAEG--KEDTLALDYSLVPDDLGEED 399
                        410       420
                 ....*....|....*....|....*....
gi 291391360 672 YSTKRQRFLVDQGYSFKVITKLAGMEEEE 700
Cdd:COG1061  400 IARRRRLFLIRKGYTYRLLTADEEGELIP 428
DEXDc smart00487
DEAD-like helicases superfamily;
308-482 2.69e-17

DEAD-like helicases superfamily;


Pssm-ID: 214692 [Multi-domain]  Cd Length: 201  Bit Score: 81.00  E-value: 2.69e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360   308 IDLKPTAVLRPYQEKSLRKMFGNGRarSGVIVLPCGAGKSLVGVTAA-----CTVRKRCLVLGNSAVSVEQWKAQFKMWS 382
Cdd:smart00487   1 IEKFGFEPLRPYQKEAIEALLSGLR--DVILAAPTGSGKTLAALLPAlealkRGKGGRVLVLVPTRELAEQWAEELKKLG 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360   383 T-IDDSQICRFTSDAKDKPI------GCSVAISTYSMLGHTTKRsweaervmEWLKTQEWGLMILDEVHTIPAKMFRRVL 455
Cdd:smart00487  79 PsLGLKVVGLYGGDSKREQLrklesgKTDILVTTPGRLLDLLEN--------DKLSLSNVDLVILDEAHRLLDGGFGDQL 150
                          170       180       190
                   ....*....|....*....|....*....|..
gi 291391360   456 TIV-----QAHCKLGLTATLVREDDKIVDLNF 482
Cdd:smart00487 151 EKLlkllpKNVQLLLLSATPPEEIENLLELFL 182
HsdR COG4096
Type I site-specific restriction endonuclease, part of a restriction-modification system ...
298-619 9.42e-06

Type I site-specific restriction endonuclease, part of a restriction-modification system [Defense mechanisms];


Pssm-ID: 226581 [Multi-domain]  Cd Length: 875  Bit Score: 47.82  E-value: 9.42e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 298 RNDSVNPDINIDLKPTAVLRPYQEKSLRKM---FGNGRARSgVIVLPCGAGKSLVGVT-----AACTVRKRCLVLGNSAV 369
Cdd:COG4096  148 RQLRIQQLAYIDIDSAIGPRYYQIIAIRRVieaFSKGQNRA-LLVMATGTGKTRTAIAiidrlIKSGWVKRVLFLADRNA 226
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 370 SVEQWKAQFKmwSTIDDSQICRFTSDAKDKPiGCSVAISTYSMLghtTKRSWEAERVMEWLKTQEWGLMILDEVHTIPAK 449
Cdd:COG4096  227 LVDQAYGAFE--DFLPFGTKMNKIEDKKGDT-SSEIYLSTYQTM---TGRIEQKEDEYRRFGPGFFDLIVIDEAHRGIYS 300
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 450 MFRRVLTIVQAHcKLGLTATLVREDDK-------------------IVDlNFLIGPKLYEANwMELENNGY--------- 501
Cdd:COG4096  301 EWSSILDYFDAA-TQGLTATPKETIDRstygffngeptyaysleeaVED-GFLVPYKVIRID-TDFDLDGWkpdagsere 377
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 502 --IAKVQCAEVWCPMSPEFYREYVAIKTKKRIllytmnpnkfraCQFLIKFHERRN-----DKIIVFADNVFALKEYAIR 574
Cdd:COG4096  378 klQGEAIDEDDQNFEARDFDRTLVIPFRTETV------------ARELTEYLKRGAtgdeiGKTIVFAKNHDHAERIREA 445
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 291391360 575 LNKPY----------IYGPTSQGErmQILQNFKHNPKINTIFIS-KVGDTSFDLPE 619
Cdd:COG4096  446 LVNEYpeyngryamkITGDAEQAQ--ALIDNFIDKEKYPRIAITvDLLTTGVDVPE 499
MPH1 COG1111
ERCC4-related helicase [Replication, recombination and repair];
549-732 5.32e-04

ERCC4-related helicase [Replication, recombination and repair];


Pssm-ID: 224036 [Multi-domain]  Cd Length: 542  Bit Score: 41.94  E-value: 5.32e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 549 KFHERRNDKIIVFADNVFALKEYAIRLNKPYI------YGPT--------SQGERMQILQNFKhNPKINTIFISKVGDTS 614
Cdd:COG1111  360 QLEKNGDSRVIVFTEYRDTAEEIVNFLKKIGIkarvrfIGQAsregdkgmSQKEQKEIIDQFR-KGEYNVLVATSVGEEG 438
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 615 FDLPEANVLI-------QISShggsrrqeAQRLGRVLRAKKGMVaeeynaffYSLVSQDTQEMAY---STKRQRflvdqg 684
Cdd:COG1111  439 LDIPEVDLVIfyepvpsEIRS--------IQRKGRTGRKRKGRV--------VVLVTEGTRDEAYyysSRRKEQ------ 496
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*...
gi 291391360 685 ysfKVITKLAGMeEEELAFSTKEEQQQLLQKVLAATDLDAEEEVVAGE 732
Cdd:COG1111  497 ---KMIESIRGL-SLELKVRLPEKEEPSGDGQKIPEDAETLLEVVGEE 540
SrmB COG0513
Superfamily II DNA and RNA helicase [Replication, recombination and repair];
521-772 1.04e-03

Superfamily II DNA and RNA helicase [Replication, recombination and repair];


Pssm-ID: 223587 [Multi-domain]  Cd Length: 513  Bit Score: 40.93  E-value: 1.04e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 521 EYVAIKTKKRILLYTMNPNKFRACQFLIKFHErrNDKIIVFADNVFALKEYAIRLNK-----PYIYGPTSQGERMQILQN 595
Cdd:COG0513  241 ERTLKKIKQFYLEVESEEEKLELLLKLLKDED--EGRVIVFVRTKRLVEELAESLRKrgfkvAALHGDLPQEERDRALEK 318
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 596 FKhNPKINTIFISKVGDTSFDLPEANVLIQisSHGGSRRQEA-QRLGRVLRAKKGMVAeeynaffYSLVSQDTQEmaysT 674
Cdd:COG0513  319 FK-DGELRVLVATDVAARGLDIPDVSHVIN--YDLPLDPEDYvHRIGRTGRAGRKGVA-------ISFVTEEEEV----K 384
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 675 KRQRFLVDQGYSFKVITKLAGMEEEE--LAFSTKEEQQQLLQKVLAATDLDAEEEVVAGEFGSKSSQASRRFGTMSSMSG 752
Cdd:COG0513  385 KLKRIEKRLERKLPSAVLLPLDEPEDakLLKTTRPGLEEESDISDEIKKLKSSKKALLRGLGVRFTLSKLLANLGKEIPG 464
                        250       260
                 ....*....|....*....|
gi 291391360 753 ADDTVYMEYHSSRSKATTKH 772
Cdd:COG0513  465 AGDAVTIDPELERRSPNSAD 484
uvsW PHA02558
UvsW helicase; Provisional
317-571 1.43e-03

UvsW helicase; Provisional


Pssm-ID: 222875 [Multi-domain]  Cd Length: 501  Bit Score: 40.38  E-value: 1.43e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 317 RPYQEKSLRKMFGNGRarsGVIVLPCGAGKSLVgvtAACTVR-------KRCLVLGNSAVSVEQWKAQFKMWSTIDDS-- 387
Cdd:PHA02558 116 HWYQYDAVYEGLKNNR---RLLNLPTSAGKSLI---QYLLSRyylenyeGKVLIIVPTTSLVTQMIDDFVDYRLFPREam 189
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 388 -QICRFTSDAKDKPIgcsvAISTYSMLGHTTKrsweaervmEWLktQEWGLMILDEVHTIPAKMFRRVLTIVqAHC--KL 464
Cdd:PHA02558 190 hKIYSGTAKDTDAPI----VVSTWQSAVKQPK---------EWF--DQFGMVIVDECHLFTGKSLTSIITKL-DNCkfKF 253
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 465 GLTATLVREDDKIVDLNFLIGP--KLYEANwmELENNGYIAKVQCAEVWCPMSPEFyreyvaiktkkRILLytmnpnKFR 542
Cdd:PHA02558 254 GLTGSLRDGKANILQYVGLFGDifKPVTTS--QLMEEGQVTDLKINSIFLRYPDED-----------RVKL------KGE 314
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 291391360 543 ACQFLIKF---HERRNDKIIVFA-------DNVFALKEY 571
Cdd:PHA02558 315 DYQEEIKYitsHTKRNKWIANLAlklakkgENTFVMFKY 353
BRR2 COG1204
Replicative superfamily II helicase [Replication, recombination and repair];
337-470 8.20e-03

Replicative superfamily II helicase [Replication, recombination and repair];


Pssm-ID: 224125 [Multi-domain]  Cd Length: 766  Bit Score: 38.13  E-value: 8.20e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 337 VIVLPCGAGKSLVGVTAACtvrKRCLVLGNSAVSVEQWKA-------QFKMWS--------TIDDSQicrftsDAKDKPI 401
Cdd:COG1204   51 LISAPTGSGKTLIALLAIL---STLLEGGGKVVYIVPLKAlaeekyeEFSRLEelgirvgiSTGDYD------LDDERLA 121
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 291391360 402 GCSVAISTYSMLGHTTKRSWEaervmeWLktQEWGLMILDEVH------------TIPAKMFRRVLTIvqahcKL-GLTA 468
Cdd:COG1204  122 RYDVIVTTPEKLDSLTRKRPS------WI--EEVDLVVIDEIHllgdrtrgpvleSIVARMRRLNELI-----RIvGLSA 188

                 ..
gi 291391360 469 TL 470
Cdd:COG1204  189 TL 190
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH