NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|28211477|ref|NP_782421|]
View 

methyl-accepting chemotaxis protein [Clostridium tetani E88]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MCP_signal super family cl19050
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
438-665 8.27e-43

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


The actual alignment was detected with superfamily member cd11386:

Pssm-ID: 267403  Cd Length: 200  Bit Score: 153.16  E-value: 8.27e-43
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 438 QNFSNKIDSIVKEMMEVMEGSEDIDKLSTGGIQGMKILVKSTQKVRDSFKEFSQEIAKLATGINEVNEITNLINSIAEQT 517
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 518 NLLALNAAIEAARAGEAGRGFTVVADEIRKLSEQTKNSSKNINLIIKSI---SNKTDKIIDDTKiidKEIEKAVETings 594
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIqeqTEEAVEAMEETS---EEVEEGVEL---- 153
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 28211477 595 miqftsiangvhqvvprinsanciVTELKESKNEIIDKIESTSSISEEVSASSQEIAASSEEMTASCEEVA 665
Cdd:cd11386 154 ------------------------VEETGRAFEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Cache_1 super family cl03691
Cache domain;
182-251 1.95e-11

Cache domain;


The actual alignment was detected with superfamily member pfam02743:

Pssm-ID: 251508  Cd Length: 80  Bit Score: 61.13  E-value: 1.95e-11
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477   182 GEKMISISKTVKKQEKVIGVACIDVSLKALMRQTSRTKLGKEGYLAIADAEGRILVHKDSELIGTILKES 251
Cdd:pfam02743  11 GDLVITIAQPVYDNGDLLGVIGLDVPLEDLLKITKSIKLGKTGYAFIIDNNGKVLAHPNHEPVTKLLGDW 80
HAMP pfam00672
HAMP domain;
309-379 1.16e-06

HAMP domain;


:

Pssm-ID: 250044  Cd Length: 70  Bit Score: 46.84  E-value: 1.16e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 28211477   309 IATLLGCVINILLAYCIGNNLSKSLTNLKNVIIKFGQGNLKVQAPKKlkeRNDEIGEMANSIDKSIKNIKE 379
Cdd:pfam00672   3 LVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVS---GPDEIGELARAFNQMADRLRE 70
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
285-687 8.84e-53

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


:

Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 187.89  E-value: 8.84e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 285 WKLIVILDEEEVSEDIYSIKIFSSIATLLGCVINILLAYCIGNNLSKSLTNLKNVIIKFGQGNLKVQAPKKlkeRNDEIG 364
Cdd:COG0840  40 LNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDES---SNDEFG 116
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 365 EMANSIDKSIKNIKEMMISFKQHSSNISEEAANlssiseemaslsgsVSETIQDVAKGTQGQSMDLIKIAEISQNFSNKI 444
Cdd:COG0840 117 QLAKSFNEMILNLRQIIDAVQDNAEALSGASEE--------------IAASATELSARADQQAESLEEVASAIEELSETV 182
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 445 DSIVKEMMEVMEGSEDIDKLSTGGIQGMKILVKSTQKVRDSFKEfsqEIAKLATGINEVNEITNLINSIAEQTNLLALNA 524
Cdd:COG0840 183 KEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAE---VVKKLSESSQEIEEITSVINSIAEQTNLLALNA 259
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 525 AIEAARAGEAGRGFTVVADEIRKLSEQTKNSSKNINLIIKSISNKTDKIIDDTKIIDKEIEKAVETINGSMIQFTSIANG 604
Cdd:COG0840 260 AIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAA 339
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 605 VHQVVPRInsancivtelkeskNEIIDKIESTSSISEEVSASSQEIAASSEEMTASCEEVASFAETLNNMTDEMERHINK 684
Cdd:COG0840 340 IEEVSQLI--------------SEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAK 405

                ...
gi 28211477 685 FKF 687
Cdd:COG0840 406 FKL 408
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
438-665 8.27e-43

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 153.16  E-value: 8.27e-43
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 438 QNFSNKIDSIVKEMMEVMEGSEDIDKLSTGGIQGMKILVKSTQKVRDSFKEFSQEIAKLATGINEVNEITNLINSIAEQT 517
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 518 NLLALNAAIEAARAGEAGRGFTVVADEIRKLSEQTKNSSKNINLIIKSI---SNKTDKIIDDTKiidKEIEKAVETings 594
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIqeqTEEAVEAMEETS---EEVEEGVEL---- 153
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 28211477 595 miqftsiangvhqvvprinsanciVTELKESKNEIIDKIESTSSISEEVSASSQEIAASSEEMTASCEEVA 665
Cdd:cd11386 154 ------------------------VEETGRAFEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Cache_1 pfam02743
Cache domain;
182-251 1.95e-11

Cache domain;


Pssm-ID: 251508  Cd Length: 80  Bit Score: 61.13  E-value: 1.95e-11
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477   182 GEKMISISKTVKKQEKVIGVACIDVSLKALMRQTSRTKLGKEGYLAIADAEGRILVHKDSELIGTILKES 251
Cdd:pfam02743  11 GDLVITIAQPVYDNGDLLGVIGLDVPLEDLLKITKSIKLGKTGYAFIIDNNGKVLAHPNHEPVTKLLGDW 80
HAMP pfam00672
HAMP domain;
309-379 1.16e-06

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 46.84  E-value: 1.16e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 28211477   309 IATLLGCVINILLAYCIGNNLSKSLTNLKNVIIKFGQGNLKVQAPKKlkeRNDEIGEMANSIDKSIKNIKE 379
Cdd:pfam00672   3 LVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVS---GPDEIGELARAFNQMADRLRE 70
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
285-687 8.84e-53

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 187.89  E-value: 8.84e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 285 WKLIVILDEEEVSEDIYSIKIFSSIATLLGCVINILLAYCIGNNLSKSLTNLKNVIIKFGQGNLKVQAPKKlkeRNDEIG 364
Cdd:COG0840  40 LNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDES---SNDEFG 116
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 365 EMANSIDKSIKNIKEMMISFKQHSSNISEEAANlssiseemaslsgsVSETIQDVAKGTQGQSMDLIKIAEISQNFSNKI 444
Cdd:COG0840 117 QLAKSFNEMILNLRQIIDAVQDNAEALSGASEE--------------IAASATELSARADQQAESLEEVASAIEELSETV 182
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 445 DSIVKEMMEVMEGSEDIDKLSTGGIQGMKILVKSTQKVRDSFKEfsqEIAKLATGINEVNEITNLINSIAEQTNLLALNA 524
Cdd:COG0840 183 KEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAE---VVKKLSESSQEIEEITSVINSIAEQTNLLALNA 259
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 525 AIEAARAGEAGRGFTVVADEIRKLSEQTKNSSKNINLIIKSISNKTDKIIDDTKIIDKEIEKAVETINGSMIQFTSIANG 604
Cdd:COG0840 260 AIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAA 339
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 605 VHQVVPRInsancivtelkeskNEIIDKIESTSSISEEVSASSQEIAASSEEMTASCEEVASFAETLNNMTDEMERHINK 684
Cdd:COG0840 340 IEEVSQLI--------------SEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAK 405

                ...
gi 28211477 685 FKF 687
Cdd:COG0840 406 FKL 408
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
412-677 7.07e-48

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 169.77  E-value: 7.07e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477    412 VSETIQDVAKGTQGQSMDLIKIAEISQNFSNKIDSIVKEMMEVMEGSEDIDKLSTGGIQGMKILVKSTQKVRDSFKEFSQ 491
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477    492 EIAKLATGINEVNEITNLINSIAEQTNLLALNAAIEAARAGEAGRGFTVVADEIRKLSEQTKNSSKNINLIIKSISNKTD 571
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEETN 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477    572 KIIDDTKIIDKEIEKAVETINGSMIQFTSIANGVHQVVPRINSancIVTELKESKNEiidkIESTSSISEEVSASSQEIA 651
Cdd:smart00283 162 EAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQE---IAAATDEQAAG----SEEVNAAIDEIAQVTQETA 234
                          250       260
                   ....*....|....*....|....*.
gi 28211477    652 ASSEEMTASCEEVASFAETLNNMTDE 677
Cdd:smart00283 235 AMSEEISAAAEELSGLAEELDELVER 260
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
479-686 3.84e-33

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 127.18  E-value: 3.84e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477   479 TQKVRDSFKEFSQEIAKLATGINEVNEITNLINSIAEQTNLLALNAAIEAARAGEAGRGFTVVADEIRKLSEQTKNSSKN 558
Cdd:pfam00015  18 MSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKE 97
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477   559 INLIIKSISNKTDKIIDDTKIIDKEIEKAVETINGSMIQFTSIANgvhqvvpRINSANCIVTELKESKNEIidkiestSS 638
Cdd:pfam00015  98 IEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVD-------AVAEIADIVQEIAAASDEQ-------SA 163
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 28211477   639 ISEEVSASSQEIAASSEEMTASCEEVASFAETLNNMTDEMERHINKFK 686
Cdd:pfam00015 164 GIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQFR 211
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
398-674 1.95e-24

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 106.69  E-value: 1.95e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  398 LSSISEEMASLSGSVSETIQDVAKGTQGQSMDLIKIAEISQNFSNKID----SIVKEMMEVMEGSEDIDKLSTGGIQG-- 471
Cdd:PRK09793 245 ITAIFASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEqqaaSLAQTAASMEQLTATVGQNADNARQAse 324
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  472 -MKILVKSTQKVRDSFKEFSQEIAKLATGINEVNEITNLINSIAEQTNLLALNAAIEAARAGEAGRGFTVVADEIRKLSE 550
Cdd:PRK09793 325 lAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAS 404
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  551 QTKNSSKNINLIIKSISNKTDKiidDTKIIDkeiekavetingsmiqftSIANGVHQVVPRINSANCIVTELKESKNEII 630
Cdd:PRK09793 405 RSAQAAKEIKGLIEESVNRVQQ---GSKLVN------------------NAAATMTDIVSSVTRVNDIMGEIASASEEQR 463
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 28211477  631 DKIESTSSISEEVSASSQEIAASSEEMTASCEEVASFAETLNNM 674
Cdd:PRK09793 464 RGIEQVAQAVSQMDQVTQQNASLVEEAAVATEQLANQADHLSSR 507
46 PHA02562
endonuclease subunit; Provisional
295-579 6.38e-04

endonuclease subunit; Provisional


Pssm-ID: 222878 [Multi-domain]  Cd Length: 562  Bit Score: 41.54  E-value: 6.38e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  295 EVSEDIYSIKIFSSIATLLGCVINILlaycigNNLSKSLTNLKNVIIK--FGQGNLKVQAPKKLKERNDEIGEMANSIDK 372
Cdd:PHA02562 154 KLVEDLLDISVLSEMDKLNKDKIREL------NQQIQTLDMKIDHIQQqiKTYNKNIEEQRKKNGENIARKQNKYDELVE 227
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  373 SIKNIKemmisfkqhsSNISEEAANLSSISEEMASLSGSVSETIQDVAKgtqgqsmdlikiaeisqnFSNKIDSIVKEMm 452
Cdd:PHA02562 228 EAKTIK----------AEIEELTDELLNLVMDIEDPSAALNKLNTAAAK------------------IKSKIEQFQKVI- 278
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  453 eVMegsedidkLSTGGI-----QGMKILVKSTQKVRDSFKEFSQEIAKLATGINEVNEITNLINSIaeQTNLLALNAAIE 527
Cdd:PHA02562 279 -KM--------YEKGGVcptctQQISEGPDRITKIKDKLKELQHSLEKLDTAIDELEEIMDEFNEQ--SKKLLELKNKIS 347
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....
gi 28211477  528 AARAGEAGRGFTV--VADEIRKLSEQTKNSSKNINLIIKsisNKTDKIIDDTKI 579
Cdd:PHA02562 348 TNKQSLITLVDKAkkVKAAIEELQAEFVDNAEELAKLQD---ELDKIVKTKSEL 398
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
472-685 7.95e-03

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 38.11  E-value: 7.95e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477    472 MKILVKSTQKVRDSFKEFSQEIAKLATGINEVNEITNLINSIAEQTNLLALNAAIEAARAGEagrgftvvadEIRKLSEQ 551
Cdd:TIGR02168  679 IEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEA----------EVEQLEER 748
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477    552 TKNSSKNINLIIKSISNKTDKII---DDTKIIDKEIEKAVETINGSMIQFTSIANgvhqvvpRINSANCIVTELKESKNE 628
Cdd:TIGR02168  749 IAQLSKELTELEAEIEELEERLEeaeEELAEAEAEIEELEAQIEQLKEELKALRE-------ALDELRAELTLLNEEAAN 821
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 28211477    629 IIDKIES----TSSISEEVSASSQEIAASSEEMTASCEEVASFAETLNNMTDEMERHINKF 685
Cdd:TIGR02168  822 LRERLESlerrIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNER 882
 
Name Accession Description Interval E-value
MCP_signal cd11386
Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis ...
438-665 8.27e-43

Methyl-accepting chemotaxis protein (MCP), signaling domain; Methyl-accepting chemotaxis proteins (MCPs or chemotaxis receptors) are an integral part of the transmembrane protein complex that controls bacterial chemotaxis, together with the histidine kinase CheA, the receptor-coupling protein CheW, receptor-modification enzymes, and localized phosphatases. MCPs contain a four helix trans membrane region, an N-terminal periplasmic ligand binding domain, and a C-terminal HAMP domain followed by a cytoplasmic signaling domain. This C-terminal signaling domain dimerizes into a four-helix bundle and interacts with CheA through the adaptor protein CheW.


Pssm-ID: 206779  Cd Length: 200  Bit Score: 153.16  E-value: 8.27e-43
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 438 QNFSNKIDSIVKEMMEVMEGSEDIDKLSTGGIQGMKILVKSTQKVRDSFKEFSQEIAKLATGINEVNEITNLINSIAEQT 517
Cdd:cd11386   1 EELSASIEEVAASADQVAETSQQAAELAEKGREAAEDAINQMNQIDESVDEAVSAVEELEESSAEIGEIVEVIDDIAEQT 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 518 NLLALNAAIEAARAGEAGRGFTVVADEIRKLSEQTKNSSKNINLIIKSI---SNKTDKIIDDTKiidKEIEKAVETings 594
Cdd:cd11386  81 NLLALNAAIEAARAGEAGRGFAVVADEVRKLAEESAEAAKEIEELIEEIqeqTEEAVEAMEETS---EEVEEGVEL---- 153
                       170       180       190       200       210       220       230
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 28211477 595 miqftsiangvhqvvprinsanciVTELKESKNEIIDKIESTSSISEEVSASSQEIAASSEEMTASCEEVA 665
Cdd:cd11386 154 ------------------------VEETGRAFEEIVASVEEVADGIQEISAATQEQSASTQEIAAAVEEIA 200
Cache_1 pfam02743
Cache domain;
182-251 1.95e-11

Cache domain;


Pssm-ID: 251508  Cd Length: 80  Bit Score: 61.13  E-value: 1.95e-11
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477   182 GEKMISISKTVKKQEKVIGVACIDVSLKALMRQTSRTKLGKEGYLAIADAEGRILVHKDSELIGTILKES 251
Cdd:pfam02743  11 GDLVITIAQPVYDNGDLLGVIGLDVPLEDLLKITKSIKLGKTGYAFIIDNNGKVLAHPNHEPVTKLLGDW 80
HAMP pfam00672
HAMP domain;
309-379 1.16e-06

HAMP domain;


Pssm-ID: 250044  Cd Length: 70  Bit Score: 46.84  E-value: 1.16e-06
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 28211477   309 IATLLGCVINILLAYCIGNNLSKSLTNLKNVIIKFGQGNLKVQAPKKlkeRNDEIGEMANSIDKSIKNIKE 379
Cdd:pfam00672   3 LVLLIALLLLLLLAWLLARRLLRPLRRLAEAARRIASGDLDDRVPVS---GPDEIGELARAFNQMADRLRE 70
Tar COG0840
Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction ...
285-687 8.84e-53

Methyl-accepting chemotaxis protein [Cell motility and secretion / Signal transduction mechanisms]


Pssm-ID: 223910 [Multi-domain]  Cd Length: 408  Bit Score: 187.89  E-value: 8.84e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 285 WKLIVILDEEEVSEDIYSIKIFSSIATLLGCVINILLAYCIGNNLSKSLTNLKNVIIKFGQGNLKVQAPKKlkeRNDEIG 364
Cdd:COG0840  40 LNLILDDAASAEAAALKAVLKFLLISLLVAIIVVLVLAILLLRAILEPISDLLEVVERIAAGDLTKRIDES---SNDEFG 116
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 365 EMANSIDKSIKNIKEMMISFKQHSSNISEEAANlssiseemaslsgsVSETIQDVAKGTQGQSMDLIKIAEISQNFSNKI 444
Cdd:COG0840 117 QLAKSFNEMILNLRQIIDAVQDNAEALSGASEE--------------IAASATELSARADQQAESLEEVASAIEELSETV 182
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 445 DSIVKEMMEVMEGSEDIDKLSTGGIQGMKILVKSTQKVRDSFKEfsqEIAKLATGINEVNEITNLINSIAEQTNLLALNA 524
Cdd:COG0840 183 KEVAFNAKEAAALASEASQVAEEGGEEVRQAVEQMQEIAEELAE---VVKKLSESSQEIEEITSVINSIAEQTNLLALNA 259
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 525 AIEAARAGEAGRGFTVVADEIRKLSEQTKNSSKNINLIIKSISNKTDKIIDDTKIIDKEIEKAVETINGSMIQFTSIANG 604
Cdd:COG0840 260 AIEAARAGEAGRGFAVVADEVRKLAERSADSAKEIGLLIEEIQNEAADAVEHMEESASEVSEGVKLVEETGSSLGEIAAA 339
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 605 VHQVVPRInsancivtelkeskNEIIDKIESTSSISEEVSASSQEIAASSEEMTASCEEVASFAETLNNMTDEMERHINK 684
Cdd:COG0840 340 IEEVSQLI--------------SEIAAATEEQTAVLEEINASIEELDDVTQENAAAVEELAAASEELKELAEKLLELVAK 405

                ...
gi 28211477 685 FKF 687
Cdd:COG0840 406 FKL 408
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
412-677 7.07e-48

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 169.77  E-value: 7.07e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477    412 VSETIQDVAKGTQGQSMDLIKIAEISQNFSNKIDSIVKEMMEVMEGSEDIDKLSTGGIQGMKILVKSTQKVRDSFKEFSQ 491
Cdd:smart00283   2 VSEAVEEIAAGAEEQAEELEELAERMEELSASIEEVAANADEIAATAQSAAEAAEEGREAVEDAITAMDQIREVVEEAVS 81
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477    492 EIAKLATGINEVNEITNLINSIAEQTNLLALNAAIEAARAGEAGRGFTVVADEIRKLSEQTKNSSKNINLIIKSISNKTD 571
Cdd:smart00283  82 AVEELEESSDEIGEIVSVIDDIADQTNLLALNAAIEAARAGEAGRGFAVVADEVRKLAERSAESAKEIESLIKEIQEETN 161
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477    572 KIIDDTKIIDKEIEKAVETINGSMIQFTSIANGVHQVVPRINSancIVTELKESKNEiidkIESTSSISEEVSASSQEIA 651
Cdd:smart00283 162 EAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQE---IAAATDEQAAG----SEEVNAAIDEIAQVTQETA 234
                          250       260
                   ....*....|....*....|....*.
gi 28211477    652 ASSEEMTASCEEVASFAETLNNMTDE 677
Cdd:smart00283 235 AMSEEISAAAEELSGLAEELDELVER 260
MCPsignal pfam00015
Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to ...
479-686 3.84e-33

Methyl-accepting chemotaxis protein (MCP) signalling domain; This domain is thought to transduce the signal to CheA since it is highly conserved in very diverse MCPs.


Pssm-ID: 249510 [Multi-domain]  Cd Length: 213  Bit Score: 127.18  E-value: 3.84e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477   479 TQKVRDSFKEFSQEIAKLATGINEVNEITNLINSIAEQTNLLALNAAIEAARAGEAGRGFTVVADEIRKLSEQTKNSSKN 558
Cdd:pfam00015  18 MSQIGQVVDDAVETMEELETSSKKISDIISVIDEIAFQTNLLALNAAIEAARAGEQGRGFAVVADEVRKLAERSAQAAKE 97
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477   559 INLIIKSISNKTDKIIDDTKIIDKEIEKAVETINGSMIQFTSIANgvhqvvpRINSANCIVTELKESKNEIidkiestSS 638
Cdd:pfam00015  98 IEALIEEIVKQTNDSTASIQQTRTEVEVGSTIVESTGEALKEIVD-------AVAEIADIVQEIAAASDEQ-------SA 163
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*...
gi 28211477   639 ISEEVSASSQEIAASSEEMTASCEEVASFAETLNNMTDEMERHINKFK 686
Cdd:pfam00015 164 GIDQVNQAVARIDQVTQQNAALVEESAAAAETLEEQAEELTASVAQFR 211
PRK09793 PRK09793
methyl-accepting protein IV; Provisional
398-674 1.95e-24

methyl-accepting protein IV; Provisional


Pssm-ID: 182079 [Multi-domain]  Cd Length: 533  Bit Score: 106.69  E-value: 1.95e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  398 LSSISEEMASLSGSVSETIQDVAKGTQGQSMDLIKIAEISQNFSNKID----SIVKEMMEVMEGSEDIDKLSTGGIQG-- 471
Cdd:PRK09793 245 ITAIFASLKTMQQALRGTVSDVRKGSQEMHIGIAEIVAGNNDLSSRTEqqaaSLAQTAASMEQLTATVGQNADNARQAse 324
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  472 -MKILVKSTQKVRDSFKEFSQEIAKLATGINEVNEITNLINSIAEQTNLLALNAAIEAARAGEAGRGFTVVADEIRKLSE 550
Cdd:PRK09793 325 lAKNAATTAQAGGVQVSTMTHTMQEIATSSQKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAS 404
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  551 QTKNSSKNINLIIKSISNKTDKiidDTKIIDkeiekavetingsmiqftSIANGVHQVVPRINSANCIVTELKESKNEII 630
Cdd:PRK09793 405 RSAQAAKEIKGLIEESVNRVQQ---GSKLVN------------------NAAATMTDIVSSVTRVNDIMGEIASASEEQR 463
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 28211477  631 DKIESTSSISEEVSASSQEIAASSEEMTASCEEVASFAETLNNM 674
Cdd:PRK09793 464 RGIEQVAQAVSQMDQVTQQNASLVEEAAVATEQLANQADHLSSR 507
PRK15048 PRK15048
methyl-accepting chemotaxis protein II; Provisional
296-666 4.80e-21

methyl-accepting chemotaxis protein II; Provisional


Pssm-ID: 185008 [Multi-domain]  Cd Length: 553  Bit Score: 96.23  E-value: 4.80e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  296 VSEDIYSIKIFSS----------IATLLGCVINILLA--YCIGNNLSKSLTNLKNVIIKFGQGNLKvqapKKLK-ERNDE 362
Cdd:PRK15048 171 SSEKLYRDIVTDNaddyrfaqwqLAVIALVVVLILLVawYGIRRMLLTPLAKIIAHIREIAGGNLA----NTLTiDGRSE 246
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  363 IGEMANSIDKSIKNIKEMMISFKQHSSNI----SEEAA---NLSSISEEMASlsgSVSETiqdvakgtqGQSMDLIKiAE 435
Cdd:PRK15048 247 MGDLAQSVSHMQRSLTDTVTHVREGSDAIyagtREIAAgntDLSSRTEQQAS---ALEET---------AASMEQLT-AT 313
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  436 ISQNFSNkidsiVKEMMEVMEGSEDIDKLSTGGIQGmkiLVKSTQKVRDSfkefSQEIAklatginevnEITNLINSIAE 515
Cdd:PRK15048 314 VKQNADN-----ARQASQLAQSASDTAQHGGKVVDG---VVKTMHEIADS----SKKIA----------DIISVIDGIAF 371
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  516 QTNLLALNAAIEAARAGEAGRGFTVVADEIRKLSEQTKNSSKNIN-LIIKSISNktdkiIDDTKIIdkeIEKAVETINgs 594
Cdd:PRK15048 372 QTNILALNAAVEAARAGEQGRGFAVVAGEVRNLASRSAQAAKEIKaLIEDSVSR-----VDTGSVL---VESAGETMN-- 441
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 28211477  595 miqftSIANGVHQVVPrinsancIVTELKESKNEI---IDKIESTSSISEEVSASSQEIAASSEEMTASCEEVAS 666
Cdd:PRK15048 442 -----NIVNAVTRVTD-------IMGEIASASDEQsrgIDQVALAVSEMDRVTQQNASLVQESAAAAAALEEQAS 504
PRK15041 PRK15041
methyl-accepting chemotaxis protein I; Provisional
363-666 5.40e-17

methyl-accepting chemotaxis protein I; Provisional


Pssm-ID: 185001 [Multi-domain]  Cd Length: 554  Bit Score: 83.47  E-value: 5.40e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  363 IGEMANSIDKSIKNIKEMMISFKQHSSNISEEAANLSSISEEMASLSGSVSetiQDVAKGTQGQSMDLiKIAEISQNFSN 442
Cdd:PRK15041 267 VGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVK---QNAENARQASHLAL-SASETAQRGGK 342
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  443 KIDSIVkemmevmegsedidklstggiQGMKILVKSTQKVRDsfkefsqeiaklatginevneITNLINSIAEQTNLLAL 522
Cdd:PRK15041 343 VVDNVV---------------------QTMRDISTSSQKIAD---------------------IISVIDGIAFQTNILAL 380
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  523 NAAIEAARAGEAGRGFTVVADEIRKLSEQTKNSSKNINLIIKSISNKTDkiiddtkIIDKEIEKAVETINgsmiqftSIA 602
Cdd:PRK15041 381 NAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVD-------VGSTLVESAGETMA-------EIV 446
                        250       260       270       280       290       300
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 28211477  603 NGVHQVVPrinsancIVTELKESKNEIIDKIESTSSISEEVSASSQEIAASSEEMTASC---EEVAS 666
Cdd:PRK15041 447 SAVTRVTD-------IMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAaalEEQAS 506
MA smart00283
Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo ...
481-686 4.47e-07

Methyl-accepting chemotaxis-like domains (chemotaxis sensory transducer); Thought to undergo reversible methylation in response to attractants or repellants during bacterial chemotaxis.


Pssm-ID: 214599 [Multi-domain]  Cd Length: 262  Bit Score: 50.36  E-value: 4.47e-07
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477    481 KVRDSFKEFSQEIAKLATGINEVNEITNLINSIAEQTnllalnaAIEAARAGEAGRGFTVVADEIRKLSEQTKNSSKNIN 560
Cdd:smart00283   1 DVSEAVEEIAAGAEEQAEELEELAERMEELSASIEEV-------AANADEIAATAQSAAEAAEEGREAVEDAITAMDQIR 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477    561 LI-------IKSISNKTDKIIDDTKIID---------------------------------------------KEIEKAV 588
Cdd:smart00283  74 EVveeavsaVEELEESSDEIGEIVSVIDdiadqtnllalnaaieaarageagrgfavvadevrklaersaesaKEIESLI 153
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477    589 ETINGsmiQFTSIANGVHQVVPRINSANCIVTELKESKNEIIDKIESTSSISEEVSASSQEIAASSEE------------ 656
Cdd:smart00283 154 KEIQE---ETNEAVAAMEESSSEVEEGVELVEETGDALEEIVDSVEEIADLVQEIAAATDEQAAGSEEvnaaideiaqvt 230
                          250       260       270
                   ....*....|....*....|....*....|..
gi 28211477    657 --MTASCEEVASFAETLNNMTDEMERHINKFK 686
Cdd:smart00283 231 qeTAAMSEEISAAAEELSGLAEELDELVERFK 262
COG1511 COG1511
Predicted membrane protein [Function unknown]
387-570 2.15e-04

Predicted membrane protein [Function unknown]


Pssm-ID: 224428 [Multi-domain]  Cd Length: 780  Bit Score: 43.26  E-value: 2.15e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 387 HSSNISEEAANLSSISEEMASLSGSVSETIQDVAKGTQGQSMDLIKiAEISQNFSNKIDSIV---------KEMMEVMEG 457
Cdd:COG1511 108 IPKDFSKNALSLTNKTPKKATIDYKVNEKLNAVAPKITEKAADKLL-NEISKELTETYTKVVafptiydlgGGVKGAADG 186
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477 458 SEDIDKLSTGGIQGMKILVKSTQKVRDSFKEFSQEIAKLATGINEVNEITNLINSIAEQTNLLALNAAIEAARAGEAGRG 537
Cdd:COG1511 187 AEKLKDGTDEASNGNKKLSDLLNTLNNSSATFSDGLNALTSGLTTLTDGLNQLDSGLGTLAAGIGELKQGAEQLNEGIGE 266
                       170       180       190
                ....*....|....*....|....*....|...
gi 28211477 538 FTVVADEIRKLSEQTKNSSKNINLIIKSISNKT 570
Cdd:COG1511 267 FSSGLSELNSGVQDLAAGVPQLNQGISALAAGL 299
46 PHA02562
endonuclease subunit; Provisional
295-579 6.38e-04

endonuclease subunit; Provisional


Pssm-ID: 222878 [Multi-domain]  Cd Length: 562  Bit Score: 41.54  E-value: 6.38e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  295 EVSEDIYSIKIFSSIATLLGCVINILlaycigNNLSKSLTNLKNVIIK--FGQGNLKVQAPKKLKERNDEIGEMANSIDK 372
Cdd:PHA02562 154 KLVEDLLDISVLSEMDKLNKDKIREL------NQQIQTLDMKIDHIQQqiKTYNKNIEEQRKKNGENIARKQNKYDELVE 227
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  373 SIKNIKemmisfkqhsSNISEEAANLSSISEEMASLSGSVSETIQDVAKgtqgqsmdlikiaeisqnFSNKIDSIVKEMm 452
Cdd:PHA02562 228 EAKTIK----------AEIEELTDELLNLVMDIEDPSAALNKLNTAAAK------------------IKSKIEQFQKVI- 278
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477  453 eVMegsedidkLSTGGI-----QGMKILVKSTQKVRDSFKEFSQEIAKLATGINEVNEITNLINSIaeQTNLLALNAAIE 527
Cdd:PHA02562 279 -KM--------YEKGGVcptctQQISEGPDRITKIKDKLKELQHSLEKLDTAIDELEEIMDEFNEQ--SKKLLELKNKIS 347
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....
gi 28211477  528 AARAGEAGRGFTV--VADEIRKLSEQTKNSSKNINLIIKsisNKTDKIIDDTKI 579
Cdd:PHA02562 348 TNKQSLITLVDKAkkVKAAIEELQAEFVDNAEELAKLQD---ELDKIVKTKSEL 398
Lipoprotein_7 pfam01540
Adhesin lipoprotein; This family consists of the p50 and variable adherence-associated antigen ...
325-571 8.37e-04

Adhesin lipoprotein; This family consists of the p50 and variable adherence-associated antigen (Vaa) adhesins from Mycoplasma hominis. M. hominis is a mycoplasma associated with human urogenital diseases, pneumonia, and septic arthritis. An adhesin is a cell surface molecule that mediates adhesion to other cells or to the surrounding surface or substrate. The Vaa antigen is a 50-kDa surface lipoprotein that has four tandem repetitive DNA sequences encoding a periodic peptide structure, and is highly immunogenic in the human host. p50 is also a 50-kDa lipoprotein, having three repeats A,B and C, that may be a tetramer of 191-kDa in its native environment.


Pssm-ID: 110537 [Multi-domain]  Cd Length: 353  Bit Score: 40.84  E-value: 8.37e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477   325 IGNNLSKSLTNLKNVIIKFGQGNLKVQapKKLKERNDEIgemansidksiknikemmisfkqhSSNISEeaanLSSISEE 404
Cdd:pfam01540  91 IISKLSAAVENAKNEKKAIDDKNAQIA--KELAERNAKI------------------------QSNIEE----LKKINNE 140
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477   405 MASLSGSVSETIQDVAKGTQGQSM---DLIKIAEISQNFSNKIDSIV----KEMMEVMEGSEDIDKLSTGGIQGMKilvK 477
Cdd:pfam01540 141 AFELSKTVNKTIAEVEKKFKIPKDfkeQLENFADDLLDKSRQIDEFTtvtsTQEGFTLAELESFKEITTTWFNGMK---S 217
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477   478 STQKVRDSFKEFSQEIAKLATGINEVN----EITNLINSIAEQTNLLALNAAIEAARAGEAGRGFTvvaDEIRKLSEQTK 553
Cdd:pfam01540 218 EWARVLDAWKNELTEINSIIKGVEELKklshEISEFSNSVKKTISELEKKFKIDDKTNKEEAKKFK---NELENFADQLL 294
                         250
                  ....*....|....*...
gi 28211477   554 NSSKNINLIIKSISNKTD 571
Cdd:pfam01540 295 NKSHEIDKFVTVTSARGD 312
SMC_prok_B TIGR02168
chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of ...
472-685 7.95e-03

chromosome segregation protein SMC, common bacterial type; SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins].


Pssm-ID: 233757 [Multi-domain]  Cd Length: 1179  Bit Score: 38.11  E-value: 7.95e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477    472 MKILVKSTQKVRDSFKEFSQEIAKLATGINEVNEITNLINSIAEQTNLLALNAAIEAARAGEagrgftvvadEIRKLSEQ 551
Cdd:TIGR02168  679 IEELEEKIEELEEKIAELEKALAELRKELEELEEELEQLRKELEELSRQISALRKDLARLEA----------EVEQLEER 748
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28211477    552 TKNSSKNINLIIKSISNKTDKII---DDTKIIDKEIEKAVETINGSMIQFTSIANgvhqvvpRINSANCIVTELKESKNE 628
Cdd:TIGR02168  749 IAQLSKELTELEAEIEELEERLEeaeEELAEAEAEIEELEAQIEQLKEELKALRE-------ALDELRAELTLLNEEAAN 821
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 28211477    629 IIDKIES----TSSISEEVSASSQEIAASSEEMTASCEEVASFAETLNNMTDEMERHINKF 685
Cdd:TIGR02168  822 LRERLESlerrIAATERRLEDLEEQIEELSEDIESLAAEIEELEELIEELESELEALLNER 882
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH