NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|27381069|ref|NP_772598|]
View 

hypothetical protein bll5958 [Bradyrhizobium diazoefficiens USDA 110]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
CHD cd07302
cyclase homology domain; Catalytic domains of the mononucleotidyl cyclases (MNC's), also ...
101-279 3.81e-57

cyclase homology domain; Catalytic domains of the mononucleotidyl cyclases (MNC's), also called cyclase homology domains (CHDs), are part of the class III nucleotidyl cyclases. This class includes eukaryotic and prokaryotic adenylate cyclases (AC's) and guanylate cyclases (GC's). They seem to share a common catalytic mechanism in their requirement for two magnesium ions to bind the polyphosphate moiety of the nucleotide.


:

Pssm-ID: 143636  Cd Length: 177  Bit Score: 195.88  E-value: 3.81e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  101 TITVLFADLSGFTAMSERLDPEVMQTLQNGLFEELTAAVQSFGGFVDKFIGDALLALFGAPAAHEDDPERAVRAALDMID 180
Cdd:cd07302    1 EVTVLFADIVGFTALSERLGPEELVELLNEYFSAFDEIIERHGGTVDKTIGDAVMAVFGLPGAHEDHAERAVRAALEMQE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  181 RTARLSERAKayAGSPLLLHVGINTGHVVAGGLGAGvAKSYSVTGDTVNTAQRLQSMAAPGEVLVGPLTHRLTRHA-FSY 259
Cdd:cd07302   81 ALAELNAERE--GGPPLRLRIGIHTGPVVAGVVGSE-RPEYTVIGDTVNLAARLESLAKPGQILVSEATYELLGDAgFEF 157
                        170       180
                 ....*....|....*....|
gi 27381069  260 DSLGEVSLKGKMGSVLVHRL 279
Cdd:cd07302  158 EELGEVELKGKSGPVRVYRL 177
TPR cd00189
Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2) ...
744-837 6.35e-03

Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here


:

Pssm-ID: 238112 [Multi-domain]  Cd Length: 100  Bit Score: 36.20  E-value: 6.35e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  744 DDAIRLYQQALavllaggEREPERLVLYERIADLCGAAGRRNTAEEHYQsaleghRALQDRISEARILRKLGRLLWDAGK 823
Cdd:cd00189   17 DEALEYYEKAL-------ELDPDNADAYYNLAAAYYKLGKYEEALEDYE------KALELDPDNAKAYYNLGLAYYKLGK 83
                         90
                 ....*....|....
gi 27381069  824 RIKAETHYAEAANL 837
Cdd:cd00189   84 YEEALEAYEKALEL 97
AAA_16 pfam13191
AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the ...
300-493 2.05e-17

AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.


:

Pssm-ID: 257559  Cd Length: 156  Bit Score: 81.35  E-value: 2.05e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    300 PLIGRDAELARMIGSLDLACGGAAQLVRLVGEAGIGKTRLVREFVARIRDQdrfaGVAIRQAACSPLgeqSYGTLAAVLR 379
Cdd:pfam13191    1 RLVGREEELERLLDALERVRSGRPGLVLLTGPSGVGKTSLLRELLERLARK----GGGVLSGKCDEL---PYAALRQLLR 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    380 SAygiaqkagateaeakVAEALSELGLATDEADRLMPLylhvlglgdpnavlrhvEPEQLRRQIFFAIRTVFERRLAL-S 458
Cdd:pfam13191   74 EL---------------LRQLLDELLPELELLPPVPGL-----------------PPDDLRNRLEDLLRRLLRRLAAReR 121
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 27381069    459 PLLIIVEDLHWADAVSLEALRFLMDRLERTRLMLL 493
Cdd:pfam13191  122 PLVLVLDDLQWADEASLALLLALARLLERLPLLLV 156
zf-ribbon_3 pfam13248
zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as ...
1-23 6.42e-04

zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as in family DZR. pfam12773.


:

Pssm-ID: 257604  Cd Length: 26  Bit Score: 38.83  E-value: 6.42e-04
                           10        20
                   ....*....|....*....|...
gi 27381069      1 MNCSCCGLEVQSGFAFCPKCGTK 23
Cdd:pfam13248    3 KFCPNCGAEVPPDAKFCPNCGAK 25
zf-ribbon_3 pfam13248
zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as ...
28-47 6.79e-04

zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as in family DZR. pfam12773.


:

Pssm-ID: 257604  Cd Length: 26  Bit Score: 38.83  E-value: 6.79e-04
                           10        20
                   ....*....|....*....|
gi 27381069     28 CPGCGFPCAPDFAYCPKCGA 47
Cdd:pfam13248    5 CPNCGAEVPPDAKFCPNCGA 24
DZR pfam12773
Double zinc ribbon; This family consists of a pair of zinc ribbon domains.
3-46 9.22e-15

Double zinc ribbon; This family consists of a pair of zinc ribbon domains.


:

Pssm-ID: 257289 [Multi-domain]  Cd Length: 45  Bit Score: 70.54  E-value: 9.22e-15
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*
gi 27381069      3 CSCCGLEVQSGFAFCPKCGTKQPNA-CPGCGFPCAPDFAYCPKCG 46
Cdd:pfam12773    1 CPNCGAENPSGAKFCPHCGTSLPPReCPSCGAPVDPNARFCPNCG 45
TPR_12 pfam13424
Tetratricopeptide repeat;
727-800 2.23e-05

Tetratricopeptide repeat;


:

Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 43.91  E-value: 2.23e-05
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27381069    727 ARYLRAAGDRARASYANDDAIRLYQQALAVLLAGGEREPERLVLYERIADLCGAAGRRNTAEEHYQSALEGHRA 800
Cdd:pfam13424    5 AAALNNLALVLRRLGDYDEALELLEKALEIARELGEDHPETATALNNLARLYLALGDYDEALELLEKALEIRRA 78
TPR_12 pfam13424
Tetratricopeptide repeat;
765-837 4.95e-04

Tetratricopeptide repeat;


:

Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 39.67  E-value: 4.95e-04
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27381069    765 PERLVLYERIADLCGAAGRRNTAEEHYQSALEGHRALQDRISE-ARILRKLGRLLWDAGKRIKAETHYAEAANL 837
Cdd:pfam13424    2 PDLAAALNNLALVLRRLGDYDEALELLEKALEIARELGEDHPEtATALNNLARLYLALGDYDEALELLEKALEI 75
TPR_12 pfam13424
Tetratricopeptide repeat;
844-929 1.12e-03

Tetratricopeptide repeat;


:

Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 38.51  E-value: 1.12e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    844 PIEWAHLLQERGRLAFRTGDHVAAARWADEALGYARSVPADADKqggleaaraIAEALNTKGVALARLGRHEEAVREVEQ 923
Cdd:pfam13424    1 HPDLAAALNNLALVLRRLGDYDEALELLEKALEIARELGEDHPE---------TATALNNLARLYLALGDYDEALELLEK 71

                   ....*.
gi 27381069    924 SVAAAE 929
Cdd:pfam13424   72 ALEIRR 77
TPR_12 pfam13424
Tetratricopeptide repeat;
897-969 4.50e-03

Tetratricopeptide repeat;


:

Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 36.59  E-value: 4.50e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 27381069    897 IAEALNTKGVALARLGRHEEAVREVEQSVAAAETAG--LLNVAcRGYTNLGVLYTII-DPAKAVEVCRRGLDVARR 969
Cdd:pfam13424    4 LAAALNNLALVLRRLGDYDEALELLEKALEIARELGedHPETA-TALNNLARLYLALgDYDEALELLEKALEIRRA 78
CyaA COG2114
Adenylate cyclase, family 3 (some proteins contain HAMP domain) [Signal transduction ...
100-291 3.51e-35

Adenylate cyclase, family 3 (some proteins contain HAMP domain) [Signal transduction mechanisms]


:

Pssm-ID: 225025 [Multi-domain]  Cd Length: 227  Bit Score: 134.98  E-value: 3.51e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  100 RTITVLFADLSGFTAMSERLDPEVMQTLQNGLFEELTAAVQSFGGFVDKFIGDALLALFGAPAAHEDDPERAVRAALDMI 179
Cdd:COG2114   45 RRVTLLFADIVGSTELSESLGDEALVELLNLYFDAVAEVVARHGGRVVKFIGDGFLAVFGRPSPLEDAVACALDLQLALR 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  180 DRTARLserakayAGSPLLLHVGINTGHVVAGGLGagvakSYSVTGDTVNTAQRLQSMAAPGEVLVGPLTHRLTR-HAFS 258
Cdd:COG2114  125 NPLARL-------RRESLRVRIGIHTGEVVVGNTG-----GYTVVGSAVNQAARLESLAKPGQVLLSEATYDLVRdLVDL 192
                        170       180       190
                 ....*....|....*....|....*....|...
gi 27381069  259 YDSLGEVSLKGKMGSVLVHRLNEPLDTPRAARG 291
Cdd:COG2114  193 FSGLGSHRLKGLARPVRVYQLCHRSLRRNLELR 225
 
Name Accession Description Interval E-value
CHD cd07302
cyclase homology domain; Catalytic domains of the mononucleotidyl cyclases (MNC's), also ...
101-279 3.81e-57

cyclase homology domain; Catalytic domains of the mononucleotidyl cyclases (MNC's), also called cyclase homology domains (CHDs), are part of the class III nucleotidyl cyclases. This class includes eukaryotic and prokaryotic adenylate cyclases (AC's) and guanylate cyclases (GC's). They seem to share a common catalytic mechanism in their requirement for two magnesium ions to bind the polyphosphate moiety of the nucleotide.


Pssm-ID: 143636  Cd Length: 177  Bit Score: 195.88  E-value: 3.81e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  101 TITVLFADLSGFTAMSERLDPEVMQTLQNGLFEELTAAVQSFGGFVDKFIGDALLALFGAPAAHEDDPERAVRAALDMID 180
Cdd:cd07302    1 EVTVLFADIVGFTALSERLGPEELVELLNEYFSAFDEIIERHGGTVDKTIGDAVMAVFGLPGAHEDHAERAVRAALEMQE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  181 RTARLSERAKayAGSPLLLHVGINTGHVVAGGLGAGvAKSYSVTGDTVNTAQRLQSMAAPGEVLVGPLTHRLTRHA-FSY 259
Cdd:cd07302   81 ALAELNAERE--GGPPLRLRIGIHTGPVVAGVVGSE-RPEYTVIGDTVNLAARLESLAKPGQILVSEATYELLGDAgFEF 157
                        170       180
                 ....*....|....*....|
gi 27381069  260 DSLGEVSLKGKMGSVLVHRL 279
Cdd:cd07302  158 EELGEVELKGKSGPVRVYRL 177
TPR cd00189
Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2) ...
744-837 6.35e-03

Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here


Pssm-ID: 238112 [Multi-domain]  Cd Length: 100  Bit Score: 36.20  E-value: 6.35e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  744 DDAIRLYQQALavllaggEREPERLVLYERIADLCGAAGRRNTAEEHYQsaleghRALQDRISEARILRKLGRLLWDAGK 823
Cdd:cd00189   17 DEALEYYEKAL-------ELDPDNADAYYNLAAAYYKLGKYEEALEDYE------KALELDPDNAKAYYNLGLAYYKLGK 83
                         90
                 ....*....|....
gi 27381069  824 RIKAETHYAEAANL 837
Cdd:cd00189   84 YEEALEAYEKALEL 97
Guanylate_cyc pfam00211
Adenylate and Guanylate cyclase catalytic domain;
100-270 1.09e-31

Adenylate and Guanylate cyclase catalytic domain;


Pssm-ID: 249682  Cd Length: 184  Bit Score: 123.51  E-value: 1.09e-31
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    100 RTITVLFADLSGFTAMSERLDPEVMQTLQNGLFEELTAAVQSFGGFVDKFIGDALLALFGAPAAHEDDPERAVRAALDMI 179
Cdd:pfam00211    7 DNVTILFADIVGFTALSSAHSPEEVVRLLNDLYTRFDELLDEHGVYKVKTIGDAYMAASGLPEPSPAHAQTIAEMALDML 86
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    180 DrtarlSERAKAYAGS-PLLLHVGINTGHVVAGGLGAgVAKSYSVTGDTVNTAQRLQSMAAPGEVLVGPLTHRL--TRHA 256
Cdd:pfam00211   87 E-----AIKSVNIPSFeGLRVRVGIHTGPVVAGVIGA-KRPRYDVWGDTVNLASRMESTGVPGKIHVSEETYRLlkTREG 160
                          170
                   ....*....|....
gi 27381069    257 FSYDSLGEVSLKGK 270
Cdd:pfam00211  161 FEFTERGEVEVKGK 174
AAA_16 pfam13191
AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the ...
300-493 2.05e-17

AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.


Pssm-ID: 257559  Cd Length: 156  Bit Score: 81.35  E-value: 2.05e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    300 PLIGRDAELARMIGSLDLACGGAAQLVRLVGEAGIGKTRLVREFVARIRDQdrfaGVAIRQAACSPLgeqSYGTLAAVLR 379
Cdd:pfam13191    1 RLVGREEELERLLDALERVRSGRPGLVLLTGPSGVGKTSLLRELLERLARK----GGGVLSGKCDEL---PYAALRQLLR 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    380 SAygiaqkagateaeakVAEALSELGLATDEADRLMPLylhvlglgdpnavlrhvEPEQLRRQIFFAIRTVFERRLAL-S 458
Cdd:pfam13191   74 EL---------------LRQLLDELLPELELLPPVPGL-----------------PPDDLRNRLEDLLRRLLRRLAAReR 121
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 27381069    459 PLLIIVEDLHWADAVSLEALRFLMDRLERTRLMLL 493
Cdd:pfam13191  122 PLVLVLDDLQWADEASLALLLALARLLERLPLLLV 156
zf-ribbon_3 pfam13248
zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as ...
1-23 6.42e-04

zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as in family DZR. pfam12773.


Pssm-ID: 257604  Cd Length: 26  Bit Score: 38.83  E-value: 6.42e-04
                           10        20
                   ....*....|....*....|...
gi 27381069      1 MNCSCCGLEVQSGFAFCPKCGTK 23
Cdd:pfam13248    3 KFCPNCGAEVPPDAKFCPNCGAK 25
zf-ribbon_3 pfam13248
zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as ...
28-47 6.79e-04

zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as in family DZR. pfam12773.


Pssm-ID: 257604  Cd Length: 26  Bit Score: 38.83  E-value: 6.79e-04
                           10        20
                   ....*....|....*....|
gi 27381069     28 CPGCGFPCAPDFAYCPKCGA 47
Cdd:pfam13248    5 CPNCGAEVPPDAKFCPNCGA 24
DZR pfam12773
Double zinc ribbon; This family consists of a pair of zinc ribbon domains.
3-46 9.22e-15

Double zinc ribbon; This family consists of a pair of zinc ribbon domains.


Pssm-ID: 257289 [Multi-domain]  Cd Length: 45  Bit Score: 70.54  E-value: 9.22e-15
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*
gi 27381069      3 CSCCGLEVQSGFAFCPKCGTKQPNA-CPGCGFPCAPDFAYCPKCG 46
Cdd:pfam12773    1 CPNCGAENPSGAKFCPHCGTSLPPReCPSCGAPVDPNARFCPNCG 45
TPR_12 pfam13424
Tetratricopeptide repeat;
727-800 2.23e-05

Tetratricopeptide repeat;


Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 43.91  E-value: 2.23e-05
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27381069    727 ARYLRAAGDRARASYANDDAIRLYQQALAVLLAGGEREPERLVLYERIADLCGAAGRRNTAEEHYQSALEGHRA 800
Cdd:pfam13424    5 AAALNNLALVLRRLGDYDEALELLEKALEIARELGEDHPETATALNNLARLYLALGDYDEALELLEKALEIRRA 78
TPR_12 pfam13424
Tetratricopeptide repeat;
765-837 4.95e-04

Tetratricopeptide repeat;


Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 39.67  E-value: 4.95e-04
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27381069    765 PERLVLYERIADLCGAAGRRNTAEEHYQSALEGHRALQDRISE-ARILRKLGRLLWDAGKRIKAETHYAEAANL 837
Cdd:pfam13424    2 PDLAAALNNLALVLRRLGDYDEALELLEKALEIARELGEDHPEtATALNNLARLYLALGDYDEALELLEKALEI 75
TPR_12 pfam13424
Tetratricopeptide repeat;
844-929 1.12e-03

Tetratricopeptide repeat;


Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 38.51  E-value: 1.12e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    844 PIEWAHLLQERGRLAFRTGDHVAAARWADEALGYARSVPADADKqggleaaraIAEALNTKGVALARLGRHEEAVREVEQ 923
Cdd:pfam13424    1 HPDLAAALNNLALVLRRLGDYDEALELLEKALEIARELGEDHPE---------TATALNNLARLYLALGDYDEALELLEK 71

                   ....*.
gi 27381069    924 SVAAAE 929
Cdd:pfam13424   72 ALEIRR 77
TPR_12 pfam13424
Tetratricopeptide repeat;
897-969 4.50e-03

Tetratricopeptide repeat;


Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 36.59  E-value: 4.50e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 27381069    897 IAEALNTKGVALARLGRHEEAVREVEQSVAAAETAG--LLNVAcRGYTNLGVLYTII-DPAKAVEVCRRGLDVARR 969
Cdd:pfam13424    4 LAAALNNLALVLRRLGDYDEALELLEKALEIARELGedHPETA-TALNNLARLYLALgDYDEALELLEKALEIRRA 78
COG3899 COG3899
Predicted ATPase [General function prediction only]
300-875 1.51e-87

Predicted ATPase [General function prediction only]


Pssm-ID: 226415 [Multi-domain]  Cd Length: 849  Bit Score: 302.39  E-value: 1.51e-87
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  300 PLIGRDAELARMIGSLDLACGGAAQLVRLVGEAGIGKTRLVREFVARIRDQDrfaGVAIRQAACSPLGEQSYGTLAAVLR 379
Cdd:COG3899    1 PLYGRETELAQLLAAFDRVSKGRGEVVLVAGESGIGKSALVNEVHKPITQQR---GYFIKGKFDQFERNIPLSPLVQAFR 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  380 SAYGIAQKAGATEAEAKVAEALSELGLATDEADRLMPLYLHVlgLGDPNAVLRHVEPEQLRRQIFFAIRTVFERRLALSP 459
Cdd:COG3899   78 DLMGQLLSESDTRILSWRARLLAALGENGQVIIDVIPELELI--IGKRPPALELSPTAAQNRFNLAFLRFIQVFTAEEHP 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  460 LLIIVEDLHWADAVSLEALRFLMDRLE---RTRLMLLFTHRPMLELDLFGSSRISHATLRLPPLGDADGQRLLAAYFSHG 536
Cdd:COG3899  156 LVIVLEDLHWADSASLKLLQLLMDRIAigaYRDNEVLLLHPLRPTLGEILKSATNITTITLAPLSRADTNQLVAATLGCT 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  537 WrEPPGRLFSRILDRAGGNPLFLEEIIRGLIEAGTLERDGVQWRMTSDEAAADIPASIQALLLARLD---RLPHQVRRLA 613
Cdd:COG3899  236 K-LLPAPLLELIFEKTKGNPFFIEEFLKALYEEGLLVFNFDTGAWQCSIASLGILATTDAVVEFLAArlqKLPGTTREVL 314
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  614 QEAAVIGPRFDAAALGAAATEPARVEAGLELLCDAE--IVEE----IAGSNSISLrTYRFTQTMLQDVIYQNLLLQRRIE 687
Cdd:COG3899  315 KAAACIGNRFDLDTLAALAEDSPALEAAALLDALQEglILPLsetyRFGSNVDIA-TYKFLHDRVQQAAYNLIPESQRQY 393
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  688 LHGRIGGALERLYGHEPERLEDLILLGHHFS------LSASKPKGARYLRAAGDRARASYANDDAIRLYQQALAVLLAGG 761
Cdd:COG3899  394 LHLRIGQLLEQNIPEAGQEEEIFDIVNQLNAgvglitLEEAVDELAELNLLAGRKAKLRSAYSAAISYLERGLSLLLADA 473
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  762 EREPERLVL--YERIADLCGAAGRRNTAEEHYQSALEGHRALQDRiseARILRKLGRLLWDAGKRIKAETHYAEAANLLG 839
Cdd:COG3899  474 WQNQYLLALmlHRLAAENAYLRGQFELSESLIEVVLICAASNLDG---AKVYELVIQAYTAQKQRLEAIALGQNALQLLG 550
                        570       580       590
                 ....*....|....*....|....*....|....*..
gi 27381069  840 GIDAPIEW-AHLLQERGRLAFRTGDHVAAARWADEAL 875
Cdd:COG3899  551 IAFPEKPClAELNQAGEEINQLLGDRAIEELLNLPAM 587
TOMM_kin_cyc TIGR03903
TOMM system kinase/cyclase fusion protein; This model represents proteins of 1350 in length, ...
99-1053 7.16e-54

TOMM system kinase/cyclase fusion protein; This model represents proteins of 1350 in length, in multiple species of Burkholderia, in Acidovorax avenae subsp. citrulli AAC00-1 and Delftia acidovorans SPH-1, and in multiple copies in Sorangium cellulosum, in genomic neighborhoods that include a cyclodehydratase/docking scaffold fusion protein (TIGR03882) and a member of the thiazole/oxazole modified metabolite (TOMM) precursor family TIGR03795. It has a kinase domain in the N-terminal 300 amino acids, followed by a cyclase homology domain, followed by regions without named domain definitions. It is a probable bacteriocin-like metabolite biosynthesis protein [Cellular processes, Toxin production and resistance].


Pssm-ID: 234389 [Multi-domain]  Cd Length: 1266  Bit Score: 204.69  E-value: 7.16e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069     99 RRTITVLFADLS----GFTAMSERLDPEVMQTLQNGLFEELTAAVQSFGGFVDKFIGDALLALFGAPAAHEDDPERAVRA 174
Cdd:TIGR03903  284 RRQLTALCCHVGlstpPEPAEGVEEDDEELDLLLRSWLTRCADIAVRYGAHVGGVLGDTLLFYFGYPSAAERDARRAARA 363
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    175 ALDMIDRTARLSERAKAYAGSPLLLHVGINTGHVVAGGLGAgvaksysVTGDTVNTAQRLQSMAAPGEVLVGPLTHRLTR 254
Cdd:TIGR03903  364 ALEMVRQAGRKGEAAAGEGKWRVEIAAGIHTGLVLAQAPHA-------SGGTTPNAAVRMQAQAEPGQILVSEAARKLLR 436
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    255 HAFSYDSLG-EVSLKGKMGSVLVHRLNEpldtpRAARG-LDTLGLN--APLIGRDAELARMIGSLDLACGGAAQLVRLVG 330
Cdd:TIGR03903  437 RHADFDPTAlEEAAAGAESQPVFELLGE-----RAARTpFTSLDGGttTPLVGRSRELEALRRRWRDTVAGRGRAILVVG 511
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    331 EAGIGKTRLVREFVARIRDQdrfaGVAIRQAACSPlgEQSYGTLAAVL---RSAYGIAQKAGATEAEAKVAEALSELGLA 407
Cdd:TIGR03903  512 EAGIGKSRLVHELVEKVRGR----PHAFLECRCLP--EQENHALFPVLrlvRAHWGLDRNAPPEQALAAIDALLTANGCD 585
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    408 TDEAdrlMPLYLHVLGLGDPNAVLRHVEPEQLRRQIFFAIRTVFERRLALSPLLIIVEDLHWADAVSLEALRFLMDRLER 487
Cdd:TIGR03903  586 LAEA---RPLLAGWLSLPGGAYPVPEWSPARQKELLFDVLVQLLFSLAQGAPVLLLVEDLHWADSATLEFLAALAEDPAT 662
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    488 TRLMLLFTHRPMLELDLFGSSRISHATLRLPPlgdADGQRLLAAYFshgwrePPGRL----FSRILDRAGGNPLFLEEII 563
Cdd:TIGR03903  663 ARLCLVLTARPERLPRWRMGAALRVQLRRLDR---ARAEEMVSGLL------QPTPLpravLDQLVSRTDGVPLFIEELA 733
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    564 RGLIEaGTLERDGVqwrmTSDEAAAD---IPASIQALLLARLDRLpHQVRRLAQEAAVIGPRFDAAALGAAATEP-ARVE 639
Cdd:TIGR03903  734 RMLME-TLPGRDGE----LPSRAQADrlpIPSTLRDSLELRFDRL-GPARETAQLAATIGREFDAELLADASPHDeAELD 807
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    640 AGLELLCDAEIVEEiagSNSISLRTYRFTQTMLQDVIYQNLLLQRRIELHGRIGGALERlygHEPE-RLEDLILLGHHFS 718
Cdd:TIGR03903  808 RDLRALADARLVYA---QHRVGNPSYLFRHALIRDAAYESMLRAMRREVHERVAAALLA---RFPRvVAARPDLLALHFA 881
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    719 LSASKPKGARYLRAAGDRARASYANDDAIRLYQQALAVLLAGGEREPERLVL---------------------YERIADL 777
Cdd:TIGR03903  882 RADAFAQAVPYGIKAARRALMRSLNDEAIRYATAVLAWLEVVDEAERAEDELgldgtliharmarhgwadpqiRERIEQS 961
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    778 CGAAGRRNTAEEHYQSA--------LEGHRALQDRISEAriLRKLGRLLWDAGKRIKAET----------HYAEAANLLg 839
Cdd:TIGR03903  962 LELVDLLGDSPLVAPALwtlgtyhhVAGHRVGVRRIGER--LLALARQSGDAGLVVAADTglgmalwvegRYAEAREAF- 1038
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    840 giDAPIEWAHLLQERGRLAFRTGDHVAaarWADEALGYAR-----SVPADADKQGGLEAARAIAEaLNTKGVALARLGRH 914
Cdd:TIGR03903 1039 --DAALALYDARRDAKHAVYLGLDTRA---WAQAARAFVRwglgdDDLAAAYARSAVTWATCLDH-LPSLGLTMMYLARF 1112
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    915 EEAVREVEQSVAAAETAGLLN-----VACRGYTNLGVLYTIIDPAKAvevcRRGLDVARRIGDLgfqaRLLANFAVACCT 989
Cdd:TIGR03903 1113 LQAQGDRDQARAVADAALELShryglPAVEVYAAVIRAWAVRDRAGA----RADIDALRQSGCG----LGLTYYASLLAE 1184
                          970       980       990      1000      1010      1020
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 27381069    990 FTDRCTEEGVPAA--EKAIEIDRALDQREHLAVPLIVLGQ-IHQCHFRPDLAALCYNEAIEVANETG 1053
Cdd:TIGR03903 1185 LDAERGRYGAALAiiDECLALAESPDERYYLAELLLKKGRcLRAAGERAVAAEACLRRAVEVARQQG 1251
CyaA COG2114
Adenylate cyclase, family 3 (some proteins contain HAMP domain) [Signal transduction ...
100-291 3.51e-35

Adenylate cyclase, family 3 (some proteins contain HAMP domain) [Signal transduction mechanisms]


Pssm-ID: 225025 [Multi-domain]  Cd Length: 227  Bit Score: 134.98  E-value: 3.51e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  100 RTITVLFADLSGFTAMSERLDPEVMQTLQNGLFEELTAAVQSFGGFVDKFIGDALLALFGAPAAHEDDPERAVRAALDMI 179
Cdd:COG2114   45 RRVTLLFADIVGSTELSESLGDEALVELLNLYFDAVAEVVARHGGRVVKFIGDGFLAVFGRPSPLEDAVACALDLQLALR 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  180 DRTARLserakayAGSPLLLHVGINTGHVVAGGLGagvakSYSVTGDTVNTAQRLQSMAAPGEVLVGPLTHRLTR-HAFS 258
Cdd:COG2114  125 NPLARL-------RRESLRVRIGIHTGEVVVGNTG-----GYTVVGSAVNQAARLESLAKPGQVLLSEATYDLVRdLVDL 192
                        170       180       190
                 ....*....|....*....|....*....|...
gi 27381069  259 YDSLGEVSLKGKMGSVLVHRLNEPLDTPRAARG 291
Cdd:COG2114  193 FSGLGSHRLKGLARPVRVYQLCHRSLRRNLELR 225
CYCc smart00044
Adenylyl- / guanylyl cyclase, catalytic domain; Present in two copies in mammalian adenylyl ...
99-252 1.92e-26

Adenylyl- / guanylyl cyclase, catalytic domain; Present in two copies in mammalian adenylyl cyclases. Eubacterial homologues are known. Two residues (Asn, Arg) are thought to be involved in catalysis. These cyclases have important roles in a diverse range of cellular processes.


Pssm-ID: 214485 [Multi-domain]  Cd Length: 194  Bit Score: 108.88  E-value: 1.92e-26
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069      99 RRTITVLFADLSGFTAMSERLDPEVMQTLQNGLFEELTAAVQSFGGFVDKFIGDALLALFGAPaaHEDDPERAVRAALDM 178
Cdd:smart00044   34 YDNVTILFSDIVGFTSLCSTSTPEQVVNLLNDLYSRFDQIIDRHGGYKVKTIGDAYMVASGLP--EEALVDHAELIADEA 111
                            90       100       110       120       130       140       150
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27381069     179 IDRTARLSERAKAYAGSPLLLHVGINTGHVVAGGLGAgVAKSYSVTGDTVNTAQRLQSMAAPGEVLVGPLTHRL 252
Cdd:smart00044  112 LDMVEELKTVLVQHREEGLRVRIGIHTGPVVAGVVGI-RMPRYCLFGDTVNLASRMESAGDPGQIQVSEETYSL 184
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
3-82 6.22e-05

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 45.82  E-value: 6.22e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069     3 CSCCGLEVQSGFAFCPKCG---TKQPnaCPGCGFPCAPDFAYCPKCGAFVAEV--------PTGGQASARTSPTTPPIRS 71
Cdd:PRK14559    4 CPQCQFENPNNNRFCQKCGtslTHKP--CPQCGTEVPVDEAHCPNCGAETGTIwwaiiaqaSPNSEVLESGEATQQSESS 81
                          90
                  ....*....|.
gi 27381069    72 SSPPLAPAEEA 82
Cdd:PRK14559   82 LTPSSSPLYGS 92
T7SS_EccA TIGR03922
type VII secretion AAA-ATPase EccA; This model represents the AAA family ATPase, EccA, of the ...
828-962 1.21e-04

type VII secretion AAA-ATPase EccA; This model represents the AAA family ATPase, EccA, of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccA1, EccA2, etc [Protein fate, Protein and peptide secretion and trafficking].


Pssm-ID: 188437 [Multi-domain]  Cd Length: 557  Bit Score: 44.45  E-value: 1.21e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    828 ETHYAEAANLLGGIDAP-IEWAHLLQERGRLAFRTGdhvaaaRWAD--EALGYARSVPADADKqggleAARAIAEALntk 904
Cdd:TIGR03922   84 AGEYAEADRLLAGVEARrPGWVDARWVRVVIYYRTQ------RWPDvlNQLPPGVGWPSLDDK-----AAHAAAAAH--- 149
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 27381069    905 GVALARLGRHEEAVREVEQSVAAAETAGLLNVACRGYTNLGVLYTIIDPAKAVEVCRR 962
Cdd:TIGR03922  150 GVALARLGMFAEALRRLEEAIEGPRGPAAAPVADGAYAKAMVLRALGEEDEAQELLQD 207
clpA COG0542
ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, ...
300-347 1.92e-03

ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]


Pssm-ID: 223616 [Multi-domain]  Cd Length: 786  Bit Score: 40.73  E-value: 1.92e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 27381069  300 PLIGRDAELARMIgsldlacggaAQLVR-------LVGEAGIGKTRLVREFVARI 347
Cdd:COG0542  171 PVIGRDEEIRRTI----------QILSRrtknnpvLVGEPGVGKTAIVEGLAQRI 215
TPR_12 pfam13424
Tetratricopeptide repeat;
808-880 1.97e-03

Tetratricopeptide repeat;


Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 37.74  E-value: 1.97e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27381069    808 ARILRKLGRLLWDAGKRIKAETHYAEAANLLGGI-DAPIEWAHLLQERGRLAFRTGDHVAAARWADEALGYARS 880
Cdd:pfam13424    5 AAALNNLALVLRRLGDYDEALELLEKALEIARELgEDHPETATALNNLARLYLALGDYDEALELLEKALEIRRA 78
PRK04841 PRK04841
transcriptional regulator MalT; Provisional
1004-1081 5.30e-03

transcriptional regulator MalT; Provisional


Pssm-ID: 235315 [Multi-domain]  Cd Length: 903  Bit Score: 39.54  E-value: 5.30e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  1004 KAIEI-DRALD--QREHLA-VPLI-----VLGQIHQCHFRPDLAALCYNEAIEVANETGEPQQLfPCYDGLATLSLDRGD 1074
Cdd:PRK04841  549 AAYETqEKAFQliEEQHLEqLPMHefllrIRAQLLWEWARLDEAEQCARKGLEVLSNYQPQQQL-QCLAMLAKISLARGD 627

                  ....*..
gi 27381069  1075 MPEADRY 1081
Cdd:PRK04841  628 LDNARRY 634
 
Name Accession Description Interval E-value
CHD cd07302
cyclase homology domain; Catalytic domains of the mononucleotidyl cyclases (MNC's), also ...
101-279 3.81e-57

cyclase homology domain; Catalytic domains of the mononucleotidyl cyclases (MNC's), also called cyclase homology domains (CHDs), are part of the class III nucleotidyl cyclases. This class includes eukaryotic and prokaryotic adenylate cyclases (AC's) and guanylate cyclases (GC's). They seem to share a common catalytic mechanism in their requirement for two magnesium ions to bind the polyphosphate moiety of the nucleotide.


Pssm-ID: 143636  Cd Length: 177  Bit Score: 195.88  E-value: 3.81e-57
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  101 TITVLFADLSGFTAMSERLDPEVMQTLQNGLFEELTAAVQSFGGFVDKFIGDALLALFGAPAAHEDDPERAVRAALDMID 180
Cdd:cd07302    1 EVTVLFADIVGFTALSERLGPEELVELLNEYFSAFDEIIERHGGTVDKTIGDAVMAVFGLPGAHEDHAERAVRAALEMQE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  181 RTARLSERAKayAGSPLLLHVGINTGHVVAGGLGAGvAKSYSVTGDTVNTAQRLQSMAAPGEVLVGPLTHRLTRHA-FSY 259
Cdd:cd07302   81 ALAELNAERE--GGPPLRLRIGIHTGPVVAGVVGSE-RPEYTVIGDTVNLAARLESLAKPGQILVSEATYELLGDAgFEF 157
                        170       180
                 ....*....|....*....|
gi 27381069  260 DSLGEVSLKGKMGSVLVHRL 279
Cdd:cd07302  158 EELGEVELKGKSGPVRVYRL 177
TPR cd00189
Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2) ...
744-837 6.35e-03

Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here


Pssm-ID: 238112 [Multi-domain]  Cd Length: 100  Bit Score: 36.20  E-value: 6.35e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  744 DDAIRLYQQALavllaggEREPERLVLYERIADLCGAAGRRNTAEEHYQsaleghRALQDRISEARILRKLGRLLWDAGK 823
Cdd:cd00189   17 DEALEYYEKAL-------ELDPDNADAYYNLAAAYYKLGKYEEALEDYE------KALELDPDNAKAYYNLGLAYYKLGK 83
                         90
                 ....*....|....
gi 27381069  824 RIKAETHYAEAANL 837
Cdd:cd00189   84 YEEALEAYEKALEL 97
Guanylate_cyc pfam00211
Adenylate and Guanylate cyclase catalytic domain;
100-270 1.09e-31

Adenylate and Guanylate cyclase catalytic domain;


Pssm-ID: 249682  Cd Length: 184  Bit Score: 123.51  E-value: 1.09e-31
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    100 RTITVLFADLSGFTAMSERLDPEVMQTLQNGLFEELTAAVQSFGGFVDKFIGDALLALFGAPAAHEDDPERAVRAALDMI 179
Cdd:pfam00211    7 DNVTILFADIVGFTALSSAHSPEEVVRLLNDLYTRFDELLDEHGVYKVKTIGDAYMAASGLPEPSPAHAQTIAEMALDML 86
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    180 DrtarlSERAKAYAGS-PLLLHVGINTGHVVAGGLGAgVAKSYSVTGDTVNTAQRLQSMAAPGEVLVGPLTHRL--TRHA 256
Cdd:pfam00211   87 E-----AIKSVNIPSFeGLRVRVGIHTGPVVAGVIGA-KRPRYDVWGDTVNLASRMESTGVPGKIHVSEETYRLlkTREG 160
                          170
                   ....*....|....
gi 27381069    257 FSYDSLGEVSLKGK 270
Cdd:pfam00211  161 FEFTERGEVEVKGK 174
Nucleotidyl_cyc_III cd07556
Class III nucleotidyl cyclases; Class III nucleotidyl cyclases are the largest, most diverse ...
102-244 3.63e-24

Class III nucleotidyl cyclases; Class III nucleotidyl cyclases are the largest, most diverse group of nucleotidyl cyclases (NC's) containing prokaryotic and eukaryotic proteins. They can be divided into two major groups; the mononucleotidyl cyclases (MNC's) and the diguanylate cyclases (DGC's). The MNC's, which include the adenylate cyclases (AC's) and the guanylate cyclases (GC's), have a conserved cyclase homology domain (CHD), while the DGC's have a conserved GGDEF domain, named after a conserved motif within this subgroup. Their products, cyclic guanylyl and adenylyl nucleotides, are second messengers that play important roles in eukaryotic signal transduction and prokaryotic sensory pathways.


Pssm-ID: 143637  Cd Length: 133  Bit Score: 100.51  E-value: 3.63e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  102 ITVLFADLSGFTAMSERLDPEVMQTLQNGLFEELTAAVQSFGGFVDKFIGDALLALFGApaaheDDPERAVRAALDMIDR 181
Cdd:cd07556    2 VTILFADIVGFTSLADALGPDEGDELLNELAGRFDSLIRRSGDLKIKTIGDEFMVVSGL-----DHPAAAVAFAEDMREA 76
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 27381069  182 TARLSERakayAGSPLLLHVGINTGHVVAGGLGAgvAKSYSVTGDTVNTAQRLQSMAAPGEVL 244
Cdd:cd07556   77 VSALNQS----EGNPVRVRIGIHTGPVVVGVIGS--RPQYDVWGALVNLASRMESQAKAGQVL 133
AAA_16 pfam13191
AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the ...
300-493 2.05e-17

AAA ATPase domain; This family of domains contain a P-loop motif that is characteristic of the AAA superfamily.


Pssm-ID: 257559  Cd Length: 156  Bit Score: 81.35  E-value: 2.05e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    300 PLIGRDAELARMIGSLDLACGGAAQLVRLVGEAGIGKTRLVREFVARIRDQdrfaGVAIRQAACSPLgeqSYGTLAAVLR 379
Cdd:pfam13191    1 RLVGREEELERLLDALERVRSGRPGLVLLTGPSGVGKTSLLRELLERLARK----GGGVLSGKCDEL---PYAALRQLLR 73
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    380 SAygiaqkagateaeakVAEALSELGLATDEADRLMPLylhvlglgdpnavlrhvEPEQLRRQIFFAIRTVFERRLAL-S 458
Cdd:pfam13191   74 EL---------------LRQLLDELLPELELLPPVPGL-----------------PPDDLRNRLEDLLRRLLRRLAAReR 121
                          170       180       190
                   ....*....|....*....|....*....|....*
gi 27381069    459 PLLIIVEDLHWADAVSLEALRFLMDRLERTRLMLL 493
Cdd:pfam13191  122 PLVLVLDDLQWADEASLALLLALARLLERLPLLLV 156
zf-ribbon_3 pfam13248
zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as ...
1-23 6.42e-04

zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as in family DZR. pfam12773.


Pssm-ID: 257604  Cd Length: 26  Bit Score: 38.83  E-value: 6.42e-04
                           10        20
                   ....*....|....*....|...
gi 27381069      1 MNCSCCGLEVQSGFAFCPKCGTK 23
Cdd:pfam13248    3 KFCPNCGAEVPPDAKFCPNCGAK 25
zf-ribbon_3 pfam13248
zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as ...
28-47 6.79e-04

zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as in family DZR. pfam12773.


Pssm-ID: 257604  Cd Length: 26  Bit Score: 38.83  E-value: 6.79e-04
                           10        20
                   ....*....|....*....|
gi 27381069     28 CPGCGFPCAPDFAYCPKCGA 47
Cdd:pfam13248    5 CPNCGAEVPPDAKFCPNCGA 24
zinc_ribbon_2 pfam13240
zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as ...
3-24 1.80e-03

zinc-ribbon domain; This family consists of a single zinc ribbon domain, ie half of a pair as in family DZR. pfam12773.


Pssm-ID: 257597  Cd Length: 23  Bit Score: 37.49  E-value: 1.80e-03
                           10        20
                   ....*....|....*....|..
gi 27381069      3 CSCCGLEVQSGFAFCPKCGTKQ 24
Cdd:pfam13240    2 CPNCGAELPDGAKFCPNCGAPL 23
AAA_22 pfam13401
AAA domain;
323-419 9.58e-03

AAA domain;


Pssm-ID: 257726  Cd Length: 124  Bit Score: 36.11  E-value: 9.58e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    323 AQLVRLVGEAGIGKTRLVREFVARiRDQDRFAGV---------AIRQAACSPLGEQ-SYGTLAAVLRSAYGIAQKAGAT- 391
Cdd:pfam13401    4 AGIGVLTGESGSGKTTLLRRLANQ-LPNRRVLYVeapslgtpkDLLRKILRALGLPlKGGTTAELLEALLDALRRRGRPl 82
                           90       100       110
                   ....*....|....*....|....*....|..
gi 27381069    392 ----EAEAKVAEALSELGLATDEADRLMPLYL 419
Cdd:pfam13401   83 liidEAQHLSLEALEELRDLLDLSEKGIQVIL 114
DZR pfam12773
Double zinc ribbon; This family consists of a pair of zinc ribbon domains.
3-46 9.22e-15

Double zinc ribbon; This family consists of a pair of zinc ribbon domains.


Pssm-ID: 257289 [Multi-domain]  Cd Length: 45  Bit Score: 70.54  E-value: 9.22e-15
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*
gi 27381069      3 CSCCGLEVQSGFAFCPKCGTKQPNA-CPGCGFPCAPDFAYCPKCG 46
Cdd:pfam12773    1 CPNCGAENPSGAKFCPHCGTSLPPReCPSCGAPVDPNARFCPNCG 45
TPR_12 pfam13424
Tetratricopeptide repeat;
727-800 2.23e-05

Tetratricopeptide repeat;


Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 43.91  E-value: 2.23e-05
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27381069    727 ARYLRAAGDRARASYANDDAIRLYQQALAVLLAGGEREPERLVLYERIADLCGAAGRRNTAEEHYQSALEGHRA 800
Cdd:pfam13424    5 AAALNNLALVLRRLGDYDEALELLEKALEIARELGEDHPETATALNNLARLYLALGDYDEALELLEKALEIRRA 78
TPR_12 pfam13424
Tetratricopeptide repeat;
765-837 4.95e-04

Tetratricopeptide repeat;


Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 39.67  E-value: 4.95e-04
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27381069    765 PERLVLYERIADLCGAAGRRNTAEEHYQSALEGHRALQDRISE-ARILRKLGRLLWDAGKRIKAETHYAEAANL 837
Cdd:pfam13424    2 PDLAAALNNLALVLRRLGDYDEALELLEKALEIARELGEDHPEtATALNNLARLYLALGDYDEALELLEKALEI 75
TPR_12 pfam13424
Tetratricopeptide repeat;
844-929 1.12e-03

Tetratricopeptide repeat;


Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 38.51  E-value: 1.12e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    844 PIEWAHLLQERGRLAFRTGDHVAAARWADEALGYARSVPADADKqggleaaraIAEALNTKGVALARLGRHEEAVREVEQ 923
Cdd:pfam13424    1 HPDLAAALNNLALVLRRLGDYDEALELLEKALEIARELGEDHPE---------TATALNNLARLYLALGDYDEALELLEK 71

                   ....*.
gi 27381069    924 SVAAAE 929
Cdd:pfam13424   72 ALEIRR 77
TPR_12 pfam13424
Tetratricopeptide repeat;
897-969 4.50e-03

Tetratricopeptide repeat;


Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 36.59  E-value: 4.50e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 27381069    897 IAEALNTKGVALARLGRHEEAVREVEQSVAAAETAG--LLNVAcRGYTNLGVLYTII-DPAKAVEVCRRGLDVARR 969
Cdd:pfam13424    4 LAAALNNLALVLRRLGDYDEALELLEKALEIARELGedHPETA-TALNNLARLYLALgDYDEALELLEKALEIRRA 78
COG3899 COG3899
Predicted ATPase [General function prediction only]
300-875 1.51e-87

Predicted ATPase [General function prediction only]


Pssm-ID: 226415 [Multi-domain]  Cd Length: 849  Bit Score: 302.39  E-value: 1.51e-87
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  300 PLIGRDAELARMIGSLDLACGGAAQLVRLVGEAGIGKTRLVREFVARIRDQDrfaGVAIRQAACSPLGEQSYGTLAAVLR 379
Cdd:COG3899    1 PLYGRETELAQLLAAFDRVSKGRGEVVLVAGESGIGKSALVNEVHKPITQQR---GYFIKGKFDQFERNIPLSPLVQAFR 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  380 SAYGIAQKAGATEAEAKVAEALSELGLATDEADRLMPLYLHVlgLGDPNAVLRHVEPEQLRRQIFFAIRTVFERRLALSP 459
Cdd:COG3899   78 DLMGQLLSESDTRILSWRARLLAALGENGQVIIDVIPELELI--IGKRPPALELSPTAAQNRFNLAFLRFIQVFTAEEHP 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  460 LLIIVEDLHWADAVSLEALRFLMDRLE---RTRLMLLFTHRPMLELDLFGSSRISHATLRLPPLGDADGQRLLAAYFSHG 536
Cdd:COG3899  156 LVIVLEDLHWADSASLKLLQLLMDRIAigaYRDNEVLLLHPLRPTLGEILKSATNITTITLAPLSRADTNQLVAATLGCT 235
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  537 WrEPPGRLFSRILDRAGGNPLFLEEIIRGLIEAGTLERDGVQWRMTSDEAAADIPASIQALLLARLD---RLPHQVRRLA 613
Cdd:COG3899  236 K-LLPAPLLELIFEKTKGNPFFIEEFLKALYEEGLLVFNFDTGAWQCSIASLGILATTDAVVEFLAArlqKLPGTTREVL 314
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  614 QEAAVIGPRFDAAALGAAATEPARVEAGLELLCDAE--IVEE----IAGSNSISLrTYRFTQTMLQDVIYQNLLLQRRIE 687
Cdd:COG3899  315 KAAACIGNRFDLDTLAALAEDSPALEAAALLDALQEglILPLsetyRFGSNVDIA-TYKFLHDRVQQAAYNLIPESQRQY 393
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  688 LHGRIGGALERLYGHEPERLEDLILLGHHFS------LSASKPKGARYLRAAGDRARASYANDDAIRLYQQALAVLLAGG 761
Cdd:COG3899  394 LHLRIGQLLEQNIPEAGQEEEIFDIVNQLNAgvglitLEEAVDELAELNLLAGRKAKLRSAYSAAISYLERGLSLLLADA 473
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  762 EREPERLVL--YERIADLCGAAGRRNTAEEHYQSALEGHRALQDRiseARILRKLGRLLWDAGKRIKAETHYAEAANLLG 839
Cdd:COG3899  474 WQNQYLLALmlHRLAAENAYLRGQFELSESLIEVVLICAASNLDG---AKVYELVIQAYTAQKQRLEAIALGQNALQLLG 550
                        570       580       590
                 ....*....|....*....|....*....|....*..
gi 27381069  840 GIDAPIEW-AHLLQERGRLAFRTGDHVAAARWADEAL 875
Cdd:COG3899  551 IAFPEKPClAELNQAGEEINQLLGDRAIEELLNLPAM 587
TOMM_kin_cyc TIGR03903
TOMM system kinase/cyclase fusion protein; This model represents proteins of 1350 in length, ...
99-1053 7.16e-54

TOMM system kinase/cyclase fusion protein; This model represents proteins of 1350 in length, in multiple species of Burkholderia, in Acidovorax avenae subsp. citrulli AAC00-1 and Delftia acidovorans SPH-1, and in multiple copies in Sorangium cellulosum, in genomic neighborhoods that include a cyclodehydratase/docking scaffold fusion protein (TIGR03882) and a member of the thiazole/oxazole modified metabolite (TOMM) precursor family TIGR03795. It has a kinase domain in the N-terminal 300 amino acids, followed by a cyclase homology domain, followed by regions without named domain definitions. It is a probable bacteriocin-like metabolite biosynthesis protein [Cellular processes, Toxin production and resistance].


Pssm-ID: 234389 [Multi-domain]  Cd Length: 1266  Bit Score: 204.69  E-value: 7.16e-54
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069     99 RRTITVLFADLS----GFTAMSERLDPEVMQTLQNGLFEELTAAVQSFGGFVDKFIGDALLALFGAPAAHEDDPERAVRA 174
Cdd:TIGR03903  284 RRQLTALCCHVGlstpPEPAEGVEEDDEELDLLLRSWLTRCADIAVRYGAHVGGVLGDTLLFYFGYPSAAERDARRAARA 363
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    175 ALDMIDRTARLSERAKAYAGSPLLLHVGINTGHVVAGGLGAgvaksysVTGDTVNTAQRLQSMAAPGEVLVGPLTHRLTR 254
Cdd:TIGR03903  364 ALEMVRQAGRKGEAAAGEGKWRVEIAAGIHTGLVLAQAPHA-------SGGTTPNAAVRMQAQAEPGQILVSEAARKLLR 436
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    255 HAFSYDSLG-EVSLKGKMGSVLVHRLNEpldtpRAARG-LDTLGLN--APLIGRDAELARMIGSLDLACGGAAQLVRLVG 330
Cdd:TIGR03903  437 RHADFDPTAlEEAAAGAESQPVFELLGE-----RAARTpFTSLDGGttTPLVGRSRELEALRRRWRDTVAGRGRAILVVG 511
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    331 EAGIGKTRLVREFVARIRDQdrfaGVAIRQAACSPlgEQSYGTLAAVL---RSAYGIAQKAGATEAEAKVAEALSELGLA 407
Cdd:TIGR03903  512 EAGIGKSRLVHELVEKVRGR----PHAFLECRCLP--EQENHALFPVLrlvRAHWGLDRNAPPEQALAAIDALLTANGCD 585
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    408 TDEAdrlMPLYLHVLGLGDPNAVLRHVEPEQLRRQIFFAIRTVFERRLALSPLLIIVEDLHWADAVSLEALRFLMDRLER 487
Cdd:TIGR03903  586 LAEA---RPLLAGWLSLPGGAYPVPEWSPARQKELLFDVLVQLLFSLAQGAPVLLLVEDLHWADSATLEFLAALAEDPAT 662
                          410       420       430       440       450       460       470       480
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    488 TRLMLLFTHRPMLELDLFGSSRISHATLRLPPlgdADGQRLLAAYFshgwrePPGRL----FSRILDRAGGNPLFLEEII 563
Cdd:TIGR03903  663 ARLCLVLTARPERLPRWRMGAALRVQLRRLDR---ARAEEMVSGLL------QPTPLpravLDQLVSRTDGVPLFIEELA 733
                          490       500       510       520       530       540       550       560
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    564 RGLIEaGTLERDGVqwrmTSDEAAAD---IPASIQALLLARLDRLpHQVRRLAQEAAVIGPRFDAAALGAAATEP-ARVE 639
Cdd:TIGR03903  734 RMLME-TLPGRDGE----LPSRAQADrlpIPSTLRDSLELRFDRL-GPARETAQLAATIGREFDAELLADASPHDeAELD 807
                          570       580       590       600       610       620       630       640
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    640 AGLELLCDAEIVEEiagSNSISLRTYRFTQTMLQDVIYQNLLLQRRIELHGRIGGALERlygHEPE-RLEDLILLGHHFS 718
Cdd:TIGR03903  808 RDLRALADARLVYA---QHRVGNPSYLFRHALIRDAAYESMLRAMRREVHERVAAALLA---RFPRvVAARPDLLALHFA 881
                          650       660       670       680       690       700       710       720
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    719 LSASKPKGARYLRAAGDRARASYANDDAIRLYQQALAVLLAGGEREPERLVL---------------------YERIADL 777
Cdd:TIGR03903  882 RADAFAQAVPYGIKAARRALMRSLNDEAIRYATAVLAWLEVVDEAERAEDELgldgtliharmarhgwadpqiRERIEQS 961
                          730       740       750       760       770       780       790       800
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    778 CGAAGRRNTAEEHYQSA--------LEGHRALQDRISEAriLRKLGRLLWDAGKRIKAET----------HYAEAANLLg 839
Cdd:TIGR03903  962 LELVDLLGDSPLVAPALwtlgtyhhVAGHRVGVRRIGER--LLALARQSGDAGLVVAADTglgmalwvegRYAEAREAF- 1038
                          810       820       830       840       850       860       870       880
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    840 giDAPIEWAHLLQERGRLAFRTGDHVAaarWADEALGYAR-----SVPADADKQGGLEAARAIAEaLNTKGVALARLGRH 914
Cdd:TIGR03903 1039 --DAALALYDARRDAKHAVYLGLDTRA---WAQAARAFVRwglgdDDLAAAYARSAVTWATCLDH-LPSLGLTMMYLARF 1112
                          890       900       910       920       930       940       950       960
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    915 EEAVREVEQSVAAAETAGLLN-----VACRGYTNLGVLYTIIDPAKAvevcRRGLDVARRIGDLgfqaRLLANFAVACCT 989
Cdd:TIGR03903 1113 LQAQGDRDQARAVADAALELShryglPAVEVYAAVIRAWAVRDRAGA----RADIDALRQSGCG----LGLTYYASLLAE 1184
                          970       980       990      1000      1010      1020
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 27381069    990 FTDRCTEEGVPAA--EKAIEIDRALDQREHLAVPLIVLGQ-IHQCHFRPDLAALCYNEAIEVANETG 1053
Cdd:TIGR03903 1185 LDAERGRYGAALAiiDECLALAESPDERYYLAELLLKKGRcLRAAGERAVAAEACLRRAVEVARQQG 1251
CyaA COG2114
Adenylate cyclase, family 3 (some proteins contain HAMP domain) [Signal transduction ...
100-291 3.51e-35

Adenylate cyclase, family 3 (some proteins contain HAMP domain) [Signal transduction mechanisms]


Pssm-ID: 225025 [Multi-domain]  Cd Length: 227  Bit Score: 134.98  E-value: 3.51e-35
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  100 RTITVLFADLSGFTAMSERLDPEVMQTLQNGLFEELTAAVQSFGGFVDKFIGDALLALFGAPAAHEDDPERAVRAALDMI 179
Cdd:COG2114   45 RRVTLLFADIVGSTELSESLGDEALVELLNLYFDAVAEVVARHGGRVVKFIGDGFLAVFGRPSPLEDAVACALDLQLALR 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  180 DRTARLserakayAGSPLLLHVGINTGHVVAGGLGagvakSYSVTGDTVNTAQRLQSMAAPGEVLVGPLTHRLTR-HAFS 258
Cdd:COG2114  125 NPLARL-------RRESLRVRIGIHTGEVVVGNTG-----GYTVVGSAVNQAARLESLAKPGQVLLSEATYDLVRdLVDL 192
                        170       180       190
                 ....*....|....*....|....*....|...
gi 27381069  259 YDSLGEVSLKGKMGSVLVHRLNEPLDTPRAARG 291
Cdd:COG2114  193 FSGLGSHRLKGLARPVRVYQLCHRSLRRNLELR 225
CYCc smart00044
Adenylyl- / guanylyl cyclase, catalytic domain; Present in two copies in mammalian adenylyl ...
99-252 1.92e-26

Adenylyl- / guanylyl cyclase, catalytic domain; Present in two copies in mammalian adenylyl cyclases. Eubacterial homologues are known. Two residues (Asn, Arg) are thought to be involved in catalysis. These cyclases have important roles in a diverse range of cellular processes.


Pssm-ID: 214485 [Multi-domain]  Cd Length: 194  Bit Score: 108.88  E-value: 1.92e-26
                            10        20        30        40        50        60        70        80
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069      99 RRTITVLFADLSGFTAMSERLDPEVMQTLQNGLFEELTAAVQSFGGFVDKFIGDALLALFGAPaaHEDDPERAVRAALDM 178
Cdd:smart00044   34 YDNVTILFSDIVGFTSLCSTSTPEQVVNLLNDLYSRFDQIIDRHGGYKVKTIGDAYMVASGLP--EEALVDHAELIADEA 111
                            90       100       110       120       130       140       150
                    ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27381069     179 IDRTARLSERAKAYAGSPLLLHVGINTGHVVAGGLGAgVAKSYSVTGDTVNTAQRLQSMAAPGEVLVGPLTHRL 252
Cdd:smart00044  112 LDMVEELKTVLVQHREEGLRVRIGIHTGPVVAGVVGI-RMPRYCLFGDTVNLASRMESAGDPGQIQVSEETYSL 184
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
3-82 6.22e-05

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 45.82  E-value: 6.22e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069     3 CSCCGLEVQSGFAFCPKCG---TKQPnaCPGCGFPCAPDFAYCPKCGAFVAEV--------PTGGQASARTSPTTPPIRS 71
Cdd:PRK14559    4 CPQCQFENPNNNRFCQKCGtslTHKP--CPQCGTEVPVDEAHCPNCGAETGTIwwaiiaqaSPNSEVLESGEATQQSESS 81
                          90
                  ....*....|.
gi 27381069    72 SSPPLAPAEEA 82
Cdd:PRK14559   82 LTPSSSPLYGS 92
T7SS_EccA TIGR03922
type VII secretion AAA-ATPase EccA; This model represents the AAA family ATPase, EccA, of the ...
828-962 1.21e-04

type VII secretion AAA-ATPase EccA; This model represents the AAA family ATPase, EccA, of the actinobacterial flavor of type VII secretion systems. Species such as Mycobacterium tuberculosis have several instances of this system per genome, designated EccA1, EccA2, etc [Protein fate, Protein and peptide secretion and trafficking].


Pssm-ID: 188437 [Multi-domain]  Cd Length: 557  Bit Score: 44.45  E-value: 1.21e-04
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069    828 ETHYAEAANLLGGIDAP-IEWAHLLQERGRLAFRTGdhvaaaRWAD--EALGYARSVPADADKqggleAARAIAEALntk 904
Cdd:TIGR03922   84 AGEYAEADRLLAGVEARrPGWVDARWVRVVIYYRTQ------RWPDvlNQLPPGVGWPSLDDK-----AAHAAAAAH--- 149
                           90       100       110       120       130
                   ....*....|....*....|....*....|....*....|....*....|....*...
gi 27381069    905 GVALARLGRHEEAVREVEQSVAAAETAGLLNVACRGYTNLGVLYTIIDPAKAVEVCRR 962
Cdd:TIGR03922  150 GVALARLGMFAEALRRLEEAIEGPRGPAAAPVADGAYAKAMVLRALGEEDEAQELLQD 207
PRK14714 PRK14714
DNA polymerase II large subunit; Provisional
8-61 2.67e-04

DNA polymerase II large subunit; Provisional


Pssm-ID: 237798 [Multi-domain]  Cd Length: 1337  Bit Score: 43.91  E-value: 2.67e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 27381069     8 LEVQSGFAFCPKCGTKQP-NACPGCGFPCAPDFAyCPKCGAFVAEVPTGGQASAR 61
Cdd:PRK14714  661 IEVEVGRRRCPSCGTETYeNRCPDCGTHTEPVYV-CPDCGAEVPPDESGRVECPR 714
clpA COG0542
ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, ...
300-347 1.92e-03

ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]


Pssm-ID: 223616 [Multi-domain]  Cd Length: 786  Bit Score: 40.73  E-value: 1.92e-03
                         10        20        30        40        50
                 ....*....|....*....|....*....|....*....|....*....|....*
gi 27381069  300 PLIGRDAELARMIgsldlacggaAQLVR-------LVGEAGIGKTRLVREFVARI 347
Cdd:COG0542  171 PVIGRDEEIRRTI----------QILSRrtknnpvLVGEPGVGKTAIVEGLAQRI 215
TPR_12 pfam13424
Tetratricopeptide repeat;
808-880 1.97e-03

Tetratricopeptide repeat;


Pssm-ID: 257749 [Multi-domain]  Cd Length: 78  Bit Score: 37.74  E-value: 1.97e-03
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 27381069    808 ARILRKLGRLLWDAGKRIKAETHYAEAANLLGGI-DAPIEWAHLLQERGRLAFRTGDHVAAARWADEALGYARS 880
Cdd:pfam13424    5 AAALNNLALVLRRLGDYDEALELLEKALEIARELgEDHPETATALNNLARLYLALGDYDEALELLEKALEIRRA 78
DZR pfam12773
Double zinc ribbon; This family consists of a pair of zinc ribbon domains.
28-51 3.41e-03

Double zinc ribbon; This family consists of a pair of zinc ribbon domains.


Pssm-ID: 257289 [Multi-domain]  Cd Length: 45  Bit Score: 37.02  E-value: 3.41e-03
                           10        20
                   ....*....|....*....|....
gi 27381069     28 CPGCGFPCAPDFAYCPKCGAFVAE 51
Cdd:pfam12773    1 CPNCGAENPSGAKFCPHCGTSLPP 24
PRK04841 PRK04841
transcriptional regulator MalT; Provisional
1004-1081 5.30e-03

transcriptional regulator MalT; Provisional


Pssm-ID: 235315 [Multi-domain]  Cd Length: 903  Bit Score: 39.54  E-value: 5.30e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  1004 KAIEI-DRALD--QREHLA-VPLI-----VLGQIHQCHFRPDLAALCYNEAIEVANETGEPQQLfPCYDGLATLSLDRGD 1074
Cdd:PRK04841  549 AAYETqEKAFQliEEQHLEqLPMHefllrIRAQLLWEWARLDEAEQCARKGLEVLSNYQPQQQL-QCLAMLAKISLARGD 627

                  ....*..
gi 27381069  1075 MPEADRY 1081
Cdd:PRK04841  628 LDNARRY 634
COG4783 COG4783
Putative Zn-dependent protease, contains TPR repeats [General function prediction only]
678-861 7.58e-03

Putative Zn-dependent protease, contains TPR repeats [General function prediction only]


Pssm-ID: 227122 [Multi-domain]  Cd Length: 484  Bit Score: 38.54  E-value: 7.58e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  678 QNLLLQRRIELHGRIGGALERLYGHEPERLEDLILlghhfSLSASKPKGARYLRAAGDRARASYANDDAIRLYQQALAvl 757
Cdd:COG4783  296 LLAKRSKRGGLAAQYGRALQTYLAGQYDEALKLLQ-----PLIAAQPDNPYYLELAGDILLEANKAKEAIERLKKALA-- 368
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27381069  758 laggeREPERLVLYERIADLCGAAGRRNTAEEhyqsalEGHRALQDRISEARILRKLGRLLWDAGKRIKAETHYAEAANL 837
Cdd:COG4783  369 -----LDPNSPLLQLNLAQALLKGGKPQEAIR------ILNRYLFNDPEDPNGWDLLAQAYAELGNRAEALLARAEGYAL 437
                        170       180
                 ....*....|....*....|....
gi 27381069  838 LGGIDAPIEWAHLLQERGRLAFRT 861
Cdd:COG4783  438 AGRLEQAIIFLMRASQQVKLGFPD 461
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH