NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|27366876|ref|NP_762403|]
View 

serine/threonine protein phosphatase [Vibrio vulnificus CMCP6]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
19-250 7.58e-52

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 172.13  E-value: 7.58e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876  19 FTFSKTHAGKVRPYNEDA-----LLDMTARRVWVVADGMGGHSAGDVASQMLVDRIERFVLDTPDFGIDE----LRQMIE 89
Cdd:cd00143   1 FSAGVSDKGGDRKTNEDAvvikpNLNNEDGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDieeaLRKAFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876  90 VANREIFQYAQVHLDGKTMGSTVVLLFLQDGYFHCLWVGDSRIYLLRDNHLVQKTRDHSQVMELVEQGLLAEE---DAEK 166
Cdd:cd00143  81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGgrvSNGR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876 167 HPLANVITRAVGVEE-----TVRIDQQSGQLLHGDQFL-LCSDGLTKELSNSEIHQI-------MCADSVNQsglALLHA 233
Cdd:cd00143 161 VPGVLAVTRALGDFDlkpgvSAEPDVTVVKLTEDDDFLiLASDGLWDVLSNQEAVDIvrselakEDLQEAAQ---ELVDL 237
                       250
                ....*....|....*..
gi 27366876 234 ALVRGANDNVTCALIKV 250
Cdd:cd00143 238 ALRRGSHDNITVVVVRL 254
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
19-250 7.58e-52

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 172.13  E-value: 7.58e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876  19 FTFSKTHAGKVRPYNEDA-----LLDMTARRVWVVADGMGGHSAGDVASQMLVDRIERFVLDTPDFGIDE----LRQMIE 89
Cdd:cd00143   1 FSAGVSDKGGDRKTNEDAvvikpNLNNEDGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDieeaLRKAFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876  90 VANREIFQYAQVHLDGKTMGSTVVLLFLQDGYFHCLWVGDSRIYLLRDNHLVQKTRDHSQVMELVEQGLLAEE---DAEK 166
Cdd:cd00143  81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGgrvSNGR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876 167 HPLANVITRAVGVEE-----TVRIDQQSGQLLHGDQFL-LCSDGLTKELSNSEIHQI-------MCADSVNQsglALLHA 233
Cdd:cd00143 161 VPGVLAVTRALGDFDlkpgvSAEPDVTVVKLTEDDDFLiLASDGLWDVLSNQEAVDIvrselakEDLQEAAQ---ELVDL 237
                       250
                ....*....|....*..
gi 27366876 234 ALVRGANDNVTCALIKV 250
Cdd:cd00143 238 ALRRGSHDNITVVVVRL 254
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
17-255 4.51e-66

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 209.13  E-value: 4.51e-66
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876  17 SFFTFSKTHAGKVRPYNEDALLDMTARR-----VWVVADGMGGHSAGDVASQMLVDRIERFVLDTPDFGIDE-----LRQ 86
Cdd:COG0631   7 SLKVAGLSDVGTVRKHNEDAFLIKPNENgnlllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNEsleelLKE 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876  87 MIEVANREIFQYAQVHLDGKTMGSTVVLLFLQDGYFHCLWVGDSRIYLLRDNHLVQKTRDHSQVMELVEQGLLAEEDAEK 166
Cdd:COG0631  87 AILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEARS 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876 167 HPLANVITRAVGVEETVRIDQQSGQLLHGDQFLLCSDGLTKELSNSEI-HQIMCADSVNQSGLALLHAALVRGANDNVTC 245
Cdd:COG0631 167 HPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIvDILKNSETPQEAADKLIELALEGGGPDNITV 246
                       250
                ....*....|
gi 27366876 246 ALIKVAKEKQ 255
Cdd:COG0631 247 VLVRLNGEGE 256
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
15-248 5.11e-28

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 108.62  E-value: 5.11e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876     15 SWSFFTFSKTHAGKVRPYNEDA---LLDMTARR-VWVVADGMGGHSAGDVASQMLVDRIER---FVLDTPDFGIDELRQM 87
Cdd:smart00332   5 KNLGLRYGLSSMQGVRKPMEDAhviTPDLSDSGgFFGVFDGHGGSEAAKFLSKNLPEILAEeliKEKDELEDVEEALRKA 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876     88 IEVANREIFQYAQVhldgkTMGSTVVLLFLQDGYFHCLWVGDSRIYLLRDNHLVQKTRDHSQVMELVEQGLLAEE---DA 164
Cdd:smart00332  85 FLSTDEEILEELEA-----LSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNEDERARIEAAGgfvIN 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876    165 EKHPLANVITRAVGVEE-----TVRIDQQSGQLL-HGDQFLLCSDGLTKELSNSEIHQI---MCADSVNQSGLALLHAAL 235
Cdd:smart00332 160 GRVNGVLALSRAIGDFFlkpyvSAEPDVTVVELTeKDDFLILASDGLWDVLSNQEVVDIvrkHLSKDPKEAAKRLIDLAL 239
                          250
                   ....*....|...
gi 27366876    236 VRGANDNVTCALI 248
Cdd:smart00332 240 ARGSKDNITVVVV 252
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
22-215 1.29e-13

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 66.57  E-value: 1.29e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876    22 SKTHAGKVrpyNEDALLDMTARRVWV--VADGMGGHSAGDVASQMLVDRIERFV---LDTPDFGIDE--LRQMIEVANRE 94
Cdd:pfam13672   4 SHIRRGLP---CQDAFAYRVLSDGWLiaVADGAGSAKYSDVGARLAVEAAVEALrelLDSGELPELEalVRQILNDILAL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876    95 IFQYAQV-HLDGKTMGSTVVLLFLQDGYFHCLWVGDSRIYLLRDNHlvqktrdhsqvmelvEQGLLAEEDaeKHPLANVI 173
Cdd:pfam13672  81 VRQEAAAqGLEPRDYATTLLLAVITPGGIVFFQIGDGAIVVRDRDG---------------ELQLLSEPD--SGEYANET 143
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....
gi 27366876   174 TRAVG--VEETVRIdqQSGQLLHGDQFLLCSDGLTKELSNSEIH 215
Cdd:pfam13672 144 TFLTSpdALEEFRI--RRLTLEPGDALALMTDGLSDSLVTEEPF 185
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
22-206 3.62e-23

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 98.20  E-value: 3.62e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876   22 SKTHAGKVRPYNEDALLDMT--------------ARRVWVVADGMGGHSAGDVASQMLVDRIERF-----VLDTPDfgID 82
Cdd:PRK14559 379 GRTDVGRQRHHNEDYFGINTriqklenphgrivqARGLYILCDGMGGHAAGEVASALAVETLQQYfqqhwQDELPD--EE 456
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876   83 ELRQMIEVANREIFqyaQVHLDGKT-----MGSTVVLLFLQDGYFHCLWVGDSRIY-LLRDNHLVQKTRDHSQVMELVEQ 156
Cdd:PRK14559 457 TIREAIYLANEAIY---DLNQQNARsgsgrMGTTLVMALVQDTQVAVAHVGDSRLYrVTRKGGLEQLTVDHEVGQREIQR 533
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
gi 27366876  157 GLLAEEdAEKHPLANVITRAVGV--EETVRIDQQSGQLLHGDQFLLCSDGLT 206
Cdd:PRK14559 534 GVEPQI-AYARPDAYQLTQALGPrdNSAIQPDIQFLEIEEDTLLLLCSDGLS 584
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
19-250 7.58e-52

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 172.13  E-value: 7.58e-52
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876  19 FTFSKTHAGKVRPYNEDA-----LLDMTARRVWVVADGMGGHSAGDVASQMLVDRIERFVLDTPDFGIDE----LRQMIE 89
Cdd:cd00143   1 FSAGVSDKGGDRKTNEDAvvikpNLNNEDGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDieeaLRKAFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876  90 VANREIFQYAQVHLDGKTMGSTVVLLFLQDGYFHCLWVGDSRIYLLRDNHLVQKTRDHSQVMELVEQGLLAEE---DAEK 166
Cdd:cd00143  81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVNEEERERIEKAGgrvSNGR 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876 167 HPLANVITRAVGVEE-----TVRIDQQSGQLLHGDQFL-LCSDGLTKELSNSEIHQI-------MCADSVNQsglALLHA 233
Cdd:cd00143 161 VPGVLAVTRALGDFDlkpgvSAEPDVTVVKLTEDDDFLiLASDGLWDVLSNQEAVDIvrselakEDLQEAAQ---ELVDL 237
                       250
                ....*....|....*..
gi 27366876 234 ALVRGANDNVTCALIKV 250
Cdd:cd00143 238 ALRRGSHDNITVVVVRL 254
PTC1 COG0631
Serine/threonine protein phosphatase [Signal transduction mechanisms]
17-255 4.51e-66

Serine/threonine protein phosphatase [Signal transduction mechanisms]


Pssm-ID: 223704  Cd Length: 262  Bit Score: 209.13  E-value: 4.51e-66
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876  17 SFFTFSKTHAGKVRPYNEDALLDMTARR-----VWVVADGMGGHSAGDVASQMLVDRIERFVLDTPDFGIDE-----LRQ 86
Cdd:COG0631   7 SLKVAGLSDVGTVRKHNEDAFLIKPNENgnlllLFAVADGMGGHAAGEVASKLAVEALARLFDETNFNSLNEsleelLKE 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876  87 MIEVANREIFQYAQVHLDGKTMGSTVVLLFLQDGYFHCLWVGDSRIYLLRDNHLVQKTRDHSQVMELVEQGLLAEEDAEK 166
Cdd:COG0631  87 AILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIITPEEARS 166
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876 167 HPLANVITRAVGVEETVRIDQQSGQLLHGDQFLLCSDGLTKELSNSEI-HQIMCADSVNQSGLALLHAALVRGANDNVTC 245
Cdd:COG0631 167 HPRRNALTRALGDFDLLEPDITELELEPGDFLLLCSDGLWDVVSDDEIvDILKNSETPQEAADKLIELALEGGGPDNITV 246
                       250
                ....*....|
gi 27366876 246 ALIKVAKEKQ 255
Cdd:COG0631 247 VLVRLNGEGE 256
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
15-248 5.11e-28

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 108.62  E-value: 5.11e-28
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876     15 SWSFFTFSKTHAGKVRPYNEDA---LLDMTARR-VWVVADGMGGHSAGDVASQMLVDRIER---FVLDTPDFGIDELRQM 87
Cdd:smart00332   5 KNLGLRYGLSSMQGVRKPMEDAhviTPDLSDSGgFFGVFDGHGGSEAAKFLSKNLPEILAEeliKEKDELEDVEEALRKA 84
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876     88 IEVANREIFQYAQVhldgkTMGSTVVLLFLQDGYFHCLWVGDSRIYLLRDNHLVQKTRDHSQVMELVEQGLLAEE---DA 164
Cdd:smart00332  85 FLSTDEEILEELEA-----LSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHKPSNEDERARIEAAGgfvIN 159
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876    165 EKHPLANVITRAVGVEE-----TVRIDQQSGQLL-HGDQFLLCSDGLTKELSNSEIHQI---MCADSVNQSGLALLHAAL 235
Cdd:smart00332 160 GRVNGVLALSRAIGDFFlkpyvSAEPDVTVVELTeKDDFLILASDGLWDVLSNQEVVDIvrkHLSKDPKEAAKRLIDLAL 239
                          250
                   ....*....|...
gi 27366876    236 VRGANDNVTCALI 248
Cdd:smart00332 240 ARGSKDNITVVVV 252
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
43-233 3.00e-15

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 70.84  E-value: 3.00e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876     43 RRVWVVADGMGGHSAGDVASQMLVDRIERFVLDTpdfgiDELRQMIEVANREIFQyaqvhLDGKTMGSTVVLLFLQD--- 119
Cdd:smart00331  30 RLLIAIADVMGKGLAAALAMSMARSALRTLLSEG-----ISLSQILERLNRAIYE-----NGEDGMFATLFLALYDFagg 99
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876    120 --GYFHClwvGDSRIYLLRDNHLVQKTRDHSqvmelveqgllaeedaekhplanviTRAVGVEETVRIDQQSGQLLHGDQ 197
Cdd:smart00331 100 tlSYANA---GHSPPYLLRADGGLVEDLDDL-------------------------GAPLGLEPDVEVDVRELTLEPGDL 151
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|..
gi 27366876    198 FLLCSDGLTKELSNS------EIHQIMCADSVNQSGLALLHA 233
Cdd:smart00331 152 LLLYTDGLTEARNPErleellEELLGSPPAEIAQRILEELLE 193
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
22-215 1.29e-13

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 66.57  E-value: 1.29e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876    22 SKTHAGKVrpyNEDALLDMTARRVWV--VADGMGGHSAGDVASQMLVDRIERFV---LDTPDFGIDE--LRQMIEVANRE 94
Cdd:pfam13672   4 SHIRRGLP---CQDAFAYRVLSDGWLiaVADGAGSAKYSDVGARLAVEAAVEALrelLDSGELPELEalVRQILNDILAL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876    95 IFQYAQV-HLDGKTMGSTVVLLFLQDGYFHCLWVGDSRIYLLRDNHlvqktrdhsqvmelvEQGLLAEEDaeKHPLANVI 173
Cdd:pfam13672  81 VRQEAAAqGLEPRDYATTLLLAVITPGGIVFFQIGDGAIVVRDRDG---------------ELQLLSEPD--SGEYANET 143
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....
gi 27366876   174 TRAVG--VEETVRIdqQSGQLLHGDQFLLCSDGLTKELSNSEIH 215
Cdd:pfam13672 144 TFLTSpdALEEFRI--RRLTLEPGDALALMTDGLSDSLVTEEPF 185
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
19-243 9.48e-12

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 62.38  E-value: 9.48e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876    19 FTFSKTHAGKVRPYNEDALLDM---------TARRVWVVADGMGGHSAGDVASQMLVDRIERfvLDTPDFGIDELRQMIE 89
Cdd:pfam00481   1 LDVGGTRMQGWRKSMEDAHIDGknlnsssgkDSWSFFAVFDGHGGSEAAKYAGKHLHTILAL--RRSFLTLRKLEDALRE 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876    90 V---ANREIFQYAQVHLDGKtMGSTVVLLFLQDGYFHCLWVGDSRIYLLRDNH-LVQKTRDHSQVME-----LVEQGLLA 160
Cdd:pfam00481  79 SfleTDEELRSDAANHEDLS-SGSTAVVALIRGNKLYVANVGDSRAVLCRNGGaIKQLTEDHKPSDEderrrIRAAGGFV 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876   161 EEDAEKHPLANViTRAVGVEE--------TVRIDQQSGQLLHGDQFL-LCSDGLTKELSNSEIHQImCADSVNQSGLALL 231
Cdd:pfam00481 158 SRNGRVNGVLAV-SRAFGDFDlkpgeqpvSAEPDITSHKITEDDEFLiLACDGLWDVLSDQEVVDI-VRSNLSDGGDPME 235
                         250
                  ....*....|....*...
gi 27366876   232 HA------ALVRGANDNV 243
Cdd:pfam00481 236 AAeklvdeAIAYGSEDNI 253
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
47-206 1.29e-04

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 40.74  E-value: 1.29e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876    47 VVADGMG-GHSAGDVASqMLVDRIERFVLDTPDFGidelrQMIEVANREIfqyaQVHLDGkTMGSTVVLLFLQDGYFHCL 125
Cdd:pfam07228   8 VIGDVMGhGLPAALLMG-MLRTALRALALEGLDPA-----EVLERLNRAL----QRNLEG-ERFATAVLAVYDPETGTLE 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876   126 WV--GDSRIYLLRDnhlvqktrDHSQVMELVEQGLLaeedaekhplanvitraVGVEETVRIDQQSGQLLHGDQFLLCSD 203
Cdd:pfam07228  77 YAnaGHPPPLLLRP--------DGGVVELLESPGLP-----------------LGVLPDAPYETAEFPLEPGDTLLLYTD 131

                  ...
gi 27366876   204 GLT 206
Cdd:pfam07228 132 GLT 134
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
22-206 3.62e-23

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 98.20  E-value: 3.62e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876   22 SKTHAGKVRPYNEDALLDMT--------------ARRVWVVADGMGGHSAGDVASQMLVDRIERF-----VLDTPDfgID 82
Cdd:PRK14559 379 GRTDVGRQRHHNEDYFGINTriqklenphgrivqARGLYILCDGMGGHAAGEVASALAVETLQQYfqqhwQDELPD--EE 456
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 27366876   83 ELRQMIEVANREIFqyaQVHLDGKT-----MGSTVVLLFLQDGYFHCLWVGDSRIY-LLRDNHLVQKTRDHSQVMELVEQ 156
Cdd:PRK14559 457 TIREAIYLANEAIY---DLNQQNARsgsgrMGTTLVMALVQDTQVAVAHVGDSRLYrVTRKGGLEQLTVDHEVGQREIQR 533
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|..
gi 27366876  157 GLLAEEdAEKHPLANVITRAVGV--EETVRIDQQSGQLLHGDQFLLCSDGLT 206
Cdd:PRK14559 534 GVEPQI-AYARPDAYQLTQALGPrdNSAIQPDIQFLEIEEDTLLLLCSDGLS 584
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.13
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH