NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|269957910|ref|YP_003327699|]
View 

protein serine/threonine phosphatase [Xylanimonas cellulosilytica DSM 15894]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
412-605 2.65e-37

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 138.58  E-value: 2.65e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  412 DGTTVGLVIGDVVGHDVEAAAAMGQLRSVVRSYAYELTTPGVVLDRVDQLVQGMRIP-RSASLVYATLRkrdddvehpgE 490
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGeRFATAVLAVYD----------P 70
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  491 ERWDMEYTRAGHLPPLLLR-DGRVRQLEQGGGSLVG-FGIVERRTAREVLRPGDVLLFYTDGLIERRDRSLK-VGLDTLV 567
Cdd:pfam07228  71 ETGTLEYANAGHPPPLLLRpDGGVVELLESPGLPLGvLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGElFGLERLL 150
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 269957910  568 ETSARITARDAAGVGEELLSRLADA----PEDDVAIVVVRLP 605
Cdd:pfam07228 151 ALLAERHGLSPEELLDALLEDLLRLgggeLEDDITLLVLRVR 192
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
625-732 3.23e-12

Histidine kinase-like ATPase domain;


:

Pssm-ID: 257897  Cd Length: 126  Bit Score: 64.58  E-value: 3.23e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  625 LPSEPASIARARHAVLRSCEAWGLADSASAE--LVVSELVANGVLHG-----WGNIALRLFDTGDGLRIEVED------- 690
Cdd:pfam13581   1 FPADLEALRAARRFVAAFLARAGLSEERLEEieLAVEEALTNAVEHAyredpGGPVRVRLEIDGDGLVVEVRDsgpgfdp 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 269957910  691 ANPAPPVTTDGHPNRVGGFGMQIVERLAD-WGWRPSGSGKLVW 732
Cdd:pfam13581  81 LELPDPDLTEPDDLPEGGRGLFLIRQLMDeVEYERGDGGNVLR 123
PAC smart00086
Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif ...
99-136 5.93e-04

Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif occurs C-terminal to a subset of all known PAS motifs. It is proposed to contribute to the PAS domain fold.


:

Pssm-ID: 197509  Cd Length: 43  Bit Score: 38.32  E-value: 5.93e-04
                           10        20        30
                   ....*....|....*....|....*....|....*...
gi 269957910    99 QCRKATGETYWSHVTFTPRRDADGRVTHFLGVSVDVSE 136
Cdd:smart00086   5 RLRRKDGSYIWVLVSASPIRDEDGEVEGILGVVRDITE 42
PAS_9 pfam13426
PAS domain;
33-136 2.51e-09

PAS domain;


:

Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 55.47  E-value: 2.51e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910   33 YDDGMPLLWVNESFARKTGLSagaepPRAVPGRPSlgpleRVLVDPVTGGVAV----PALASGEGGAFTMQCRKATGETY 108
Cdd:pfam13426   7 LDPEGRIVYANPAALRLLGYT-----REELLGKSI-----RDLFGPGTDEEAVarlrEALRNGGEVEVELELRRKDGEPF 76
                          90       100
                  ....*....|....*....|....*...
gi 269957910  109 WSHVTFTPRRDADGRVTHFLGVSVDVSE 136
Cdd:pfam13426  77 PVLVSASPVRDEDGEVVGIVGILRDITE 104
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
412-605 2.65e-37

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 138.58  E-value: 2.65e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  412 DGTTVGLVIGDVVGHDVEAAAAMGQLRSVVRSYAYELTTPGVVLDRVDQLVQGMRIP-RSASLVYATLRkrdddvehpgE 490
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGeRFATAVLAVYD----------P 70
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  491 ERWDMEYTRAGHLPPLLLR-DGRVRQLEQGGGSLVG-FGIVERRTAREVLRPGDVLLFYTDGLIERRDRSLK-VGLDTLV 567
Cdd:pfam07228  71 ETGTLEYANAGHPPPLLLRpDGGVVELLESPGLPLGvLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGElFGLERLL 150
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 269957910  568 ETSARITARDAAGVGEELLSRLADA----PEDDVAIVVVRLP 605
Cdd:pfam07228 151 ALLAERHGLSPEELLDALLEDLLRLgggeLEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
386-555 8.30e-26

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 105.89  E-value: 8.30e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910   386 LDVWTYYAPNAEHAQVGGDWYDVLDIDGTTVGLVIGDVVGHDVEAAAAMGQLRSVVRSYAYELTTPGVVLDRVDQLV-QG 464
Cdd:smart00331   1 DDGGLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIyEN 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910   465 MRIPRSASLVYATLrkrdDDVEHpgeerwDMEYTRAGHLPPLLLRDGRVRQLE-QGGGSLVGFG-IVERRTAREVLRPGD 542
Cdd:smart00331  81 GEDGMFATLFLALY----DFAGG------TLSYANAGHSPPYLLRADGGLVEDlDDLGAPLGLEpDVEVDVRELTLEPGD 150
                          170
                   ....*....|...
gi 269957910   543 VLLFYTDGLIERR 555
Cdd:smart00331 151 LLLLYTDGLTEAR 163
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
625-732 3.23e-12

Histidine kinase-like ATPase domain;


Pssm-ID: 257897  Cd Length: 126  Bit Score: 64.58  E-value: 3.23e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  625 LPSEPASIARARHAVLRSCEAWGLADSASAE--LVVSELVANGVLHG-----WGNIALRLFDTGDGLRIEVED------- 690
Cdd:pfam13581   1 FPADLEALRAARRFVAAFLARAGLSEERLEEieLAVEEALTNAVEHAyredpGGPVRVRLEIDGDGLVVEVRDsgpgfdp 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 269957910  691 ANPAPPVTTDGHPNRVGGFGMQIVERLAD-WGWRPSGSGKLVW 732
Cdd:pfam13581  81 LELPDPDLTEPDDLPEGGRGLFLIRQLMDeVEYERGDGGNVLR 123
PAC smart00086
Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif ...
99-136 5.93e-04

Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif occurs C-terminal to a subset of all known PAS motifs. It is proposed to contribute to the PAS domain fold.


Pssm-ID: 197509  Cd Length: 43  Bit Score: 38.32  E-value: 5.93e-04
                           10        20        30
                   ....*....|....*....|....*....|....*...
gi 269957910    99 QCRKATGETYWSHVTFTPRRDADGRVTHFLGVSVDVSE 136
Cdd:smart00086   5 RLRRKDGSYIWVLVSASPIRDEDGEVEGILGVVRDITE 42
HATPase_c smart00387
Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
657-719 6.89e-04

Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.


Pssm-ID: 214643  Cd Length: 111  Bit Score: 38.78  E-value: 6.89e-04
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 269957910   657 VVSELVANGVLHGW--GNIALRLFDTGDGLRIEVED-----------ANPAPPVTTDGHPNRVGGFGM--QIVERLAD 719
Cdd:smart00387   9 VLSNLLDNAIKYTPegGRITVTLERDGDHVEITVEDngpgippedleKIFEPFFRTDKRSRKIGGTGLglSIVKKLVE 86
RsbW COG2172
Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]
646-719 7.86e-04

Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]


Pssm-ID: 225083  Cd Length: 146  Bit Score: 39.28  E-value: 7.86e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910 646 WGLADSASAELVVSELVANGVLHG------WGNIALRLFDTGDGLRIEVED---------ANPAPPVTTDGHPnRVGGFG 710
Cdd:COG2172   33 LTYVDIADLAIAVSEALTNAVKHAykldpsEGEIRIEVSLDDGKLEIRIWDqgpgiedleESLGPGDTTAEGL-QEGGLG 111

                 ....*....
gi 269957910 711 MQIVERLAD 719
Cdd:COG2172  112 LFLAKRLMD 120
PAS_9 pfam13426
PAS domain;
33-136 2.51e-09

PAS domain;


Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 55.47  E-value: 2.51e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910   33 YDDGMPLLWVNESFARKTGLSagaepPRAVPGRPSlgpleRVLVDPVTGGVAV----PALASGEGGAFTMQCRKATGETY 108
Cdd:pfam13426   7 LDPEGRIVYANPAALRLLGYT-----REELLGKSI-----RDLFGPGTDEEAVarlrEALRNGGEVEVELELRRKDGEPF 76
                          90       100
                  ....*....|....*....|....*...
gi 269957910  109 WSHVTFTPRRDADGRVTHFLGVSVDVSE 136
Cdd:pfam13426  77 PVLVSASPVRDEDGEVVGIVGILRDITE 104
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
368-603 3.46e-25

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 107.10  E-value: 3.46e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910 368 LAEALQRAMLPE-QADVTGLDVWTYYAPnaeHAQVGGDWYDVLDIDGTTVGLVIGDVVGHDVEAAAAMGQLRSVVRSYAY 446
Cdd:COG2208  130 VARQIQQNLLPKaLPLFPGIDIEAILVP---ASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLE 206
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910 447 E-LTTPGVVLDRVDQLVQGMRIprsaSLVYATLrkrDDDVEHPgeERWDMEYTRAGHLPPLLLRDG---RVRQLEQGGGS 522
Cdd:COG2208  207 SgPLDPADVLETLNRVLKQNLE----EDMFVTL---FLGVYDL--DSGELTYSNAGHEPALILSADgeiEVEDLTALGLP 277
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910 523 LvgfGIVER---RTAREVLRPGDVLLFYTDGLIERRDRSLK-VGLDTLVETSARITARDAAGVGEELLSRLA-----DAP 593
Cdd:COG2208  278 I---GLLPDyqyEVASLQLEPGDLLVLYTDGVTEARNSDGEfFGLERLLKILGRLLGQPAEEILEAILESLEelqgdQIQ 354
                        250
                 ....*....|
gi 269957910 594 EDDVAIVVVR 603
Cdd:COG2208  355 DDDITLLVLK 364
PRK13558 PRK13558
bacterio-opsin activator; Provisional
38-171 2.31e-08

bacterio-opsin activator; Provisional


Pssm-ID: 237426 [Multi-domain]  Cd Length: 665  Bit Score: 56.00  E-value: 2.31e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  38 PLLWVNESFARKTGLsagaePPRAVPGRPSlgpleRVLVDPVTGGVAVPALASG----EGGAFTMQCRKATGETYWSHVT 113
Cdd:PRK13558 172 PLIYINDAFERITGY-----SPDEVLGRNC-----RFLQGEDTNEERVAELREAideeRPTSVELRNYRKDGSTFWNQVD 241
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 269957910 114 FTPRRDADGRVTHFLGVSVDVSEYVDERsaqlqtLAVERRQRADLDLVAQTTELLGDL 171
Cdd:PRK13558 242 IAPIRDEDGTVTHYVGFQTDVTERKEAE------LALQRERRKLQRLLERVEGLVNDV 293
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
400-603 1.55e-03

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs [Cellular processes, Sporulation and germination].


Pssm-ID: 234038 [Multi-domain]  Cd Length: 764  Bit Score: 40.45  E-value: 1.55e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  400 QVGGDWYDVLDIDGTTVGLVIGDVVGHDVEAAAAMGQLRSVVRSYAYELTTPGVVLDRVDQLvqgMRIpRSASLVYATLR 479
Cdd:TIGR02865 565 LVSGDSYSFGKLSAGKYAVAISDGMGSGPEAAQESSACVRLLEKFLESGFDREVAIKTVNSI---LSL-RSTDEKFSTLD 640
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  480 KRDDDVeHPGeerwDMEYTRAGHLPPLLLRDGRVRQLEqggGSLVGFGI---VERRTAREVLRPGDVLLFYTDGLIErRD 556
Cdd:TIGR02865 641 LSVIDL-YTG----QAEFVKVGAVPSFIKRGAKVEVIR---SSNLPIGIldeVDVELVRKKLKNGDLIVMVSDGVLE-GE 711
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 269957910  557 RSLKVGLDTLVETSARITARDAAGVGEELLSRL----ADAPEDDVAIVVVR 603
Cdd:TIGR02865 712 KEVEGKVLWLVRKLKETNTNDPEEIAEYLLEKAkelrSGKIKDDMTVIVAK 762
nifL_nitrog TIGR02938
nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation ...
34-151 3.59e-03

nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation positive regulator protein NifA, and is therefore a negative regulator. It binds NifA. NifA and NifL are encoded by adjacent genes [Central intermediary metabolism, Nitrogen fixation, Regulatory functions, Protein interactions].


Pssm-ID: 131984 [Multi-domain]  Cd Length: 494  Bit Score: 39.12  E-value: 3.59e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910   34 DDGMPLLWVNESFARKTGLSagaepPRAVPGRPslgplERVLVDPVTGGVAVPAL----ASGEGGAFTMQCRKATGETYW 109
Cdd:TIGR02938  21 DLKANILYANDAFTRITGYT-----KEEIIGKN-----ESVLSNHTTPPEVYQALwgslAEQKPWAGKLLNRRKDGELYL 90
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 269957910  110 SHVTFTPRRDADGRVTHFLGVSVDVSE-YVDERSAQLQTLAVE 151
Cdd:TIGR02938  91 AELTVAPVLNEAGETTHFLGMHRDITElHRLEQVVANQKLLIE 133
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
412-605 2.65e-37

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 138.58  E-value: 2.65e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  412 DGTTVGLVIGDVVGHDVEAAAAMGQLRSVVRSYAYELTTPGVVLDRVDQLVQGMRIP-RSASLVYATLRkrdddvehpgE 490
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGeRFATAVLAVYD----------P 70
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  491 ERWDMEYTRAGHLPPLLLR-DGRVRQLEQGGGSLVG-FGIVERRTAREVLRPGDVLLFYTDGLIERRDRSLK-VGLDTLV 567
Cdd:pfam07228  71 ETGTLEYANAGHPPPLLLRpDGGVVELLESPGLPLGvLPDAPYETAEFPLEPGDTLLLYTDGLTEARDPDGElFGLERLL 150
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 269957910  568 ETSARITARDAAGVGEELLSRLADA----PEDDVAIVVVRLP 605
Cdd:pfam07228 151 ALLAERHGLSPEELLDALLEDLLRLgggeLEDDITLLVLRVR 192
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
386-555 8.30e-26

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 105.89  E-value: 8.30e-26
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910   386 LDVWTYYAPNAEHAQVGGDWYDVLDIDGTTVGLVIGDVVGHDVEAAAAMGQLRSVVRSYAYELTTPGVVLDRVDQLV-QG 464
Cdd:smart00331   1 DDGGLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIyEN 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910   465 MRIPRSASLVYATLrkrdDDVEHpgeerwDMEYTRAGHLPPLLLRDGRVRQLE-QGGGSLVGFG-IVERRTAREVLRPGD 542
Cdd:smart00331  81 GEDGMFATLFLALY----DFAGG------TLSYANAGHSPPYLLRADGGLVEDlDDLGAPLGLEpDVEVDVRELTLEPGD 150
                          170
                   ....*....|...
gi 269957910   543 VLLFYTDGLIERR 555
Cdd:smart00331 151 LLLLYTDGLTEAR 163
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
625-732 3.23e-12

Histidine kinase-like ATPase domain;


Pssm-ID: 257897  Cd Length: 126  Bit Score: 64.58  E-value: 3.23e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  625 LPSEPASIARARHAVLRSCEAWGLADSASAE--LVVSELVANGVLHG-----WGNIALRLFDTGDGLRIEVED------- 690
Cdd:pfam13581   1 FPADLEALRAARRFVAAFLARAGLSEERLEEieLAVEEALTNAVEHAyredpGGPVRVRLEIDGDGLVVEVRDsgpgfdp 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 269957910  691 ANPAPPVTTDGHPNRVGGFGMQIVERLAD-WGWRPSGSGKLVW 732
Cdd:pfam13581  81 LELPDPDLTEPDDLPEGGRGLFLIRQLMDeVEYERGDGGNVLR 123
HATPase_c pfam02518
Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the ...
649-720 4.05e-04

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.


Pssm-ID: 251347  Cd Length: 111  Bit Score: 39.61  E-value: 4.05e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  649 ADSASAELVVSELVANGVLHG--WGNIALRLFDTGDGLRIEVEDANP-----------APPVTTDGHPNRVGGFGM--QI 713
Cdd:pfam02518   1 GDEDRLRQVLSNLLDNAIKHApaGGEIEVTLERDGGRLRITVEDNGIgippedlpkifEPFFRTDGSRSKVGGTGLglSI 80

                  ....*..
gi 269957910  714 VERLADW 720
Cdd:pfam02518  81 VRKLVEL 87
PAC smart00086
Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif ...
99-136 5.93e-04

Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain); PAC motif occurs C-terminal to a subset of all known PAS motifs. It is proposed to contribute to the PAS domain fold.


Pssm-ID: 197509  Cd Length: 43  Bit Score: 38.32  E-value: 5.93e-04
                           10        20        30
                   ....*....|....*....|....*....|....*...
gi 269957910    99 QCRKATGETYWSHVTFTPRRDADGRVTHFLGVSVDVSE 136
Cdd:smart00086   5 RLRRKDGSYIWVLVSASPIRDEDGEVEGILGVVRDITE 42
HATPase_c smart00387
Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
657-719 6.89e-04

Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.


Pssm-ID: 214643  Cd Length: 111  Bit Score: 38.78  E-value: 6.89e-04
                           10        20        30        40        50        60        70
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 269957910   657 VVSELVANGVLHGW--GNIALRLFDTGDGLRIEVED-----------ANPAPPVTTDGHPNRVGGFGM--QIVERLAD 719
Cdd:smart00387   9 VLSNLLDNAIKYTPegGRITVTLERDGDHVEITVEDngpgippedleKIFEPFFRTDKRSRKIGGTGLglSIVKKLVE 86
RsbW COG2172
Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]
646-719 7.86e-04

Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms]


Pssm-ID: 225083  Cd Length: 146  Bit Score: 39.28  E-value: 7.86e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910 646 WGLADSASAELVVSELVANGVLHG------WGNIALRLFDTGDGLRIEVED---------ANPAPPVTTDGHPnRVGGFG 710
Cdd:COG2172   33 LTYVDIADLAIAVSEALTNAVKHAykldpsEGEIRIEVSLDDGKLEIRIWDqgpgiedleESLGPGDTTAEGL-QEGGLG 111

                 ....*....
gi 269957910 711 MQIVERLAD 719
Cdd:COG2172  112 LFLAKRLMD 120
PAS_9 pfam13426
PAS domain;
33-136 2.51e-09

PAS domain;


Pssm-ID: 257751 [Multi-domain]  Cd Length: 104  Bit Score: 55.47  E-value: 2.51e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910   33 YDDGMPLLWVNESFARKTGLSagaepPRAVPGRPSlgpleRVLVDPVTGGVAV----PALASGEGGAFTMQCRKATGETY 108
Cdd:pfam13426   7 LDPEGRIVYANPAALRLLGYT-----REELLGKSI-----RDLFGPGTDEEAVarlrEALRNGGEVEVELELRRKDGEPF 76
                          90       100
                  ....*....|....*....|....*...
gi 269957910  109 WSHVTFTPRRDADGRVTHFLGVSVDVSE 136
Cdd:pfam13426  77 PVLVSASPVRDEDGEVVGIVGILRDITE 104
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
368-603 3.46e-25

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 107.10  E-value: 3.46e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910 368 LAEALQRAMLPE-QADVTGLDVWTYYAPnaeHAQVGGDWYDVLDIDGTTVGLVIGDVVGHDVEAAAAMGQLRSVVRSYAY 446
Cdd:COG2208  130 VARQIQQNLLPKaLPLFPGIDIEAILVP---ASEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLE 206
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910 447 E-LTTPGVVLDRVDQLVQGMRIprsaSLVYATLrkrDDDVEHPgeERWDMEYTRAGHLPPLLLRDG---RVRQLEQGGGS 522
Cdd:COG2208  207 SgPLDPADVLETLNRVLKQNLE----EDMFVTL---FLGVYDL--DSGELTYSNAGHEPALILSADgeiEVEDLTALGLP 277
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910 523 LvgfGIVER---RTAREVLRPGDVLLFYTDGLIERRDRSLK-VGLDTLVETSARITARDAAGVGEELLSRLA-----DAP 593
Cdd:COG2208  278 I---GLLPDyqyEVASLQLEPGDLLVLYTDGVTEARNSDGEfFGLERLLKILGRLLGQPAEEILEAILESLEelqgdQIQ 354
                        250
                 ....*....|
gi 269957910 594 EDDVAIVVVR 603
Cdd:COG2208  355 DDDITLLVLK 364
PRK13558 PRK13558
bacterio-opsin activator; Provisional
38-171 2.31e-08

bacterio-opsin activator; Provisional


Pssm-ID: 237426 [Multi-domain]  Cd Length: 665  Bit Score: 56.00  E-value: 2.31e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  38 PLLWVNESFARKTGLsagaePPRAVPGRPSlgpleRVLVDPVTGGVAVPALASG----EGGAFTMQCRKATGETYWSHVT 113
Cdd:PRK13558 172 PLIYINDAFERITGY-----SPDEVLGRNC-----RFLQGEDTNEERVAELREAideeRPTSVELRNYRKDGSTFWNQVD 241
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 269957910 114 FTPRRDADGRVTHFLGVSVDVSEYVDERsaqlqtLAVERRQRADLDLVAQTTELLGDL 171
Cdd:PRK13558 242 IAPIRDEDGTVTHYVGFQTDVTERKEAE------LALQRERRKLQRLLERVEGLVNDV 293
PRK13559 PRK13559
hypothetical protein; Provisional
12-159 1.99e-06

hypothetical protein; Provisional


Pssm-ID: 237427 [Multi-domain]  Cd Length: 361  Bit Score: 49.05  E-value: 1.99e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  12 SPELLAELAAGTELCMFLTGPYDDGMPLLWVNESFARKTGLSAgaeppRAVPGRPSlgpleRVLVDPVTGGVAV----PA 87
Cdd:PRK13559  41 SGRLFEQAMEQTRMAMCITDPHQPDLPIVLANQAFLDLTGYAA-----EEVVGRNC-----RFLQGAATDPIAVakirAA 110
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 269957910  88 LASGEGGAFTMQCRKATGETYWSHVTFTPRRDADGRVTHFLGVSVDVSEYVDERSAQlqtlAVERRQRADLD 159
Cdd:PRK13559 111 IAAEREIVVELLNYRKDGEPFWNALHLGPVYGEDGRLLYFFGSQWDVTDIRAVRALE----AHERRLAREVD 178
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
400-603 1.55e-03

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs [Cellular processes, Sporulation and germination].


Pssm-ID: 234038 [Multi-domain]  Cd Length: 764  Bit Score: 40.45  E-value: 1.55e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  400 QVGGDWYDVLDIDGTTVGLVIGDVVGHDVEAAAAMGQLRSVVRSYAYELTTPGVVLDRVDQLvqgMRIpRSASLVYATLR 479
Cdd:TIGR02865 565 LVSGDSYSFGKLSAGKYAVAISDGMGSGPEAAQESSACVRLLEKFLESGFDREVAIKTVNSI---LSL-RSTDEKFSTLD 640
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910  480 KRDDDVeHPGeerwDMEYTRAGHLPPLLLRDGRVRQLEqggGSLVGFGI---VERRTAREVLRPGDVLLFYTDGLIErRD 556
Cdd:TIGR02865 641 LSVIDL-YTG----QAEFVKVGAVPSFIKRGAKVEVIR---SSNLPIGIldeVDVELVRKKLKNGDLIVMVSDGVLE-GE 711
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|.
gi 269957910  557 RSLKVGLDTLVETSARITARDAAGVGEELLSRL----ADAPEDDVAIVVVR 603
Cdd:TIGR02865 712 KEVEGKVLWLVRKLKETNTNDPEEIAEYLLEKAkelrSGKIKDDMTVIVAK 762
COG3920 COG3920
Signal transduction histidine kinase [Signal transduction mechanisms]
656-718 1.79e-03

Signal transduction histidine kinase [Signal transduction mechanisms]


Pssm-ID: 226434 [Multi-domain]  Cd Length: 221  Bit Score: 39.17  E-value: 1.79e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910 656 LVVSELVANGVLHGWG-------NIALRLFDTGDGLRIEVEDANPAPPVTTDGHPnrvGGFGMQIVERLA 718
Cdd:COG3920  125 LIVHELVTNALKHAFLsrpggeiRITLSREGDGGRFLLTVWDEGGGPPVEAPLSR---GGFGLQLVERLV 191
PAS_4 pfam08448
PAS fold; The PAS fold corresponds to the structural domain that has previously been defined ...
39-136 2.10e-03

PAS fold; The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs. The PAS fold appears in archaea, eubacteria and eukarya.


Pssm-ID: 254806 [Multi-domain]  Cd Length: 110  Bit Score: 37.39  E-value: 2.10e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910   39 LLWVNESFARktglsAGAEPPRAVPGRPslgpLERVLVDPVTGGV--AVPALASGEGGAFTMQCRKATGETYWSHVTFTP 116
Cdd:pfam08448  17 VRYANAAAAE-----LFGLPPEELLGKT----LAELLPPEDAARLerALRRALEGEEPIDFLEELLLNGEERHYELRLTP 87
                          90       100
                  ....*....|....*....|
gi 269957910  117 RRDADGRVTHFLGVSVDVSE 136
Cdd:pfam08448  88 LRDPDGEVIGVLVISRDITE 107
nifL_nitrog TIGR02938
nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation ...
34-151 3.59e-03

nitrogen fixation negative regulator NifL; NifL is a modulator of the nitrogen fixation positive regulator protein NifA, and is therefore a negative regulator. It binds NifA. NifA and NifL are encoded by adjacent genes [Central intermediary metabolism, Nitrogen fixation, Regulatory functions, Protein interactions].


Pssm-ID: 131984 [Multi-domain]  Cd Length: 494  Bit Score: 39.12  E-value: 3.59e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 269957910   34 DDGMPLLWVNESFARKTGLSagaepPRAVPGRPslgplERVLVDPVTGGVAVPAL----ASGEGGAFTMQCRKATGETYW 109
Cdd:TIGR02938  21 DLKANILYANDAFTRITGYT-----KEEIIGKN-----ESVLSNHTTPPEVYQALwgslAEQKPWAGKLLNRRKDGELYL 90
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|...
gi 269957910  110 SHVTFTPRRDADGRVTHFLGVSVDVSE-YVDERSAQLQTLAVE 151
Cdd:TIGR02938  91 AELTVAPVLNEAGETTHFLGMHRDITElHRLEQVVANQKLLIE 133
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH