NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|26787989|ref|NP_077189|]
View 

39S ribosomal protein L28, mitochondrial [Mus musculus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ribosomal_L28 super family cl00367
Ribosomal L28 family; The ribosomal 28 family includes L28 proteins from bacteria and ...
76-136 2.02e-05

Ribosomal L28 family; The ribosomal 28 family includes L28 proteins from bacteria and chloroplasts. The L24 protein from yeast also contains a region of similarity to prokaryotic L28 proteins. L24 from yeast is also found in the large ribosomal subunit


The actual alignment was detected with superfamily member pfam00830:

Pssm-ID: 275554  Cd Length: 61  Bit Score: 40.92  E-value: 2.02e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 26787989    76 QQGLWGGEGLILGYRY--ANNdklskRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDLID 136
Cdd:pfam00830   1 RRCQLTGKGPMFGNNVshSNN-----KTKRRWKPNLQKKRLWSESLGRWVRLKVSTKALRTID 58
 
Name Accession Description Interval E-value
Ribosomal_L28 pfam00830
Ribosomal L28 family; The ribosomal 28 family includes L28 proteins from bacteria and ...
76-136 2.02e-05

Ribosomal L28 family; The ribosomal 28 family includes L28 proteins from bacteria and chloroplasts. The L24 protein from yeast also contains a region of similarity to prokaryotic L28 proteins. L24 from yeast is also found in the large ribosomal subunit


Pssm-ID: 250161  Cd Length: 61  Bit Score: 40.92  E-value: 2.02e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 26787989    76 QQGLWGGEGLILGYRY--ANNdklskRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDLID 136
Cdd:pfam00830   1 RRCQLTGKGPMFGNNVshSNN-----KTKRRWKPNLQKKRLWSESLGRWVRLKVSTKALRTID 58
RpmB COG0227
Ribosomal protein L28 [Translation, ribosomal structure and biogenesis];
75-147 5.65e-05

Ribosomal protein L28 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223305  Cd Length: 77  Bit Score: 39.99  E-value: 5.65e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 26787989  75 SQQGLWGGEGLILGYRYANNDKLSKRVkkvWKPQLFTRELYSEILDKKFTVTVTMRTLDLIDEAYGFDFYILK 147
Cdd:COG0227   2 SRRCQLTGKGPMSGNNVSHSHNKTKRR---FLPNLQKVRFWSLSDGRFKRLRVSAKALRTIDKKGKIDAVLAK 71
rpmB PRK00359
50S ribosomal protein L28; Reviewed
92-153 6.44e-03

50S ribosomal protein L28; Reviewed


Pssm-ID: 234736  Cd Length: 76  Bit Score: 33.66  E-value: 6.44e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 26787989   92 ANNdklskRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDLIDEAyGFDFYILKTPKEDL 153
Cdd:PRK00359  21 SNN-----KTKRRFLPNLQKVRFWVEEEGRFVRLRVSARALRTIDKK-GLDAVLKKARARGL 76
 
Name Accession Description Interval E-value
Ribosomal_L28 pfam00830
Ribosomal L28 family; The ribosomal 28 family includes L28 proteins from bacteria and ...
76-136 2.02e-05

Ribosomal L28 family; The ribosomal 28 family includes L28 proteins from bacteria and chloroplasts. The L24 protein from yeast also contains a region of similarity to prokaryotic L28 proteins. L24 from yeast is also found in the large ribosomal subunit


Pssm-ID: 250161  Cd Length: 61  Bit Score: 40.92  E-value: 2.02e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 26787989    76 QQGLWGGEGLILGYRY--ANNdklskRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDLID 136
Cdd:pfam00830   1 RRCQLTGKGPMFGNNVshSNN-----KTKRRWKPNLQKKRLWSESLGRWVRLKVSTKALRTID 58
RpmB COG0227
Ribosomal protein L28 [Translation, ribosomal structure and biogenesis];
75-147 5.65e-05

Ribosomal protein L28 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223305  Cd Length: 77  Bit Score: 39.99  E-value: 5.65e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 26787989  75 SQQGLWGGEGLILGYRYANNDKLSKRVkkvWKPQLFTRELYSEILDKKFTVTVTMRTLDLIDEAYGFDFYILK 147
Cdd:COG0227   2 SRRCQLTGKGPMSGNNVSHSHNKTKRR---FLPNLQKVRFWSLSDGRFKRLRVSAKALRTIDKKGKIDAVLAK 71
rpmB PRK00359
50S ribosomal protein L28; Reviewed
92-153 6.44e-03

50S ribosomal protein L28; Reviewed


Pssm-ID: 234736  Cd Length: 76  Bit Score: 33.66  E-value: 6.44e-03
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 26787989   92 ANNdklskRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDLIDEAyGFDFYILKTPKEDL 153
Cdd:PRK00359  21 SNN-----KTKRRFLPNLQKVRFWVEEEGRFVRLRVSARALRTIDKK-GLDAVLKKARARGL 76
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH