NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|266457701|ref|NP_001161166|]
View 

probable G-protein coupled receptor 19 isoform a [Mus musculus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_4 super family cl21561
Olfactory receptor; The members of this family are transmembrane olfactory receptors.
72-258 5.68e-06

Olfactory receptor; The members of this family are transmembrane olfactory receptors.


The actual alignment was detected with superfamily member pfam13853:

Pssm-ID: 304433  Cd Length: 280  Bit Score: 46.33  E-value: 5.68e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701   72 FGALWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVVLQFTTGRWTLGSAMCKVVRYFQYLTPGV 151
Cdd:pfam13853   1 FCLIYLIIFLGNCTILHVIRTESSLHQPMYLFLAMLALIDLGLSASTLPTVLGIFLFGLREISLEACLAQMFFIHKFSFM 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  152 QIYVLLSICIDRFYTIVYPLSFK--VSREKAKKMIAASWILDAAFVTPVFF------FYGSNWDSHcNYFLPPSWEGTAY 223
Cdd:pfam13853  81 ESAVLLAMAFDRFVAICSPLRYSsiLTNPVISRIGLGILVRSFILILPLIFllkrlpFCGHHVLSH-SYCLHQGLIRLSC 159
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
gi 266457701  224 TVIHF---------LVGFVIPSILIILFYQKVIKYIWRIGT-DGR 258
Cdd:pfam13853 160 ADIKVnsiyglfvvISTLGLDSLLILISYGLILHTVLGIASrEER 204
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
82-330 7.43e-42

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


:

Pssm-ID: 278431 [Multi-domain]  Cd Length: 254  Bit Score: 149.38  E-value: 7.43e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701   82 GNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVVLQFTTGRWTLGSAMCKVVRYFQYLTPGVQIYVLLSICI 161
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLLTLPFWLVYALFGTWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  162 DRFYTIVYPLSFKVSREKAKKMIAASWILDAAFVTPVFFFYGSNWDSH-----CNYFLPPSWEGTAYTVIHFLVGFVIPS 236
Cdd:pfam00001  81 DRYLAIVHPLRYRRIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIPSngvtsCLITFPESLWPVSYLLFSTVVGFLLPL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  237 ILIILFYqkvikyiWRIgtdGRTLRRTMNIVPR---TKVKTVKMFLLLNLVFLFSWLPFHVAQLWHPHEQDYKKSSLVFT 313
Cdd:pfam00001 161 LVILVCY-------TRI---IRTLRKQARSRRRsvrSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDLLIIISCVVT 230
                         250       260
                  ....*....|....*....|....
gi 266457701  314 AV-------TWVSFSSSASKPTLY 330
Cdd:pfam00001 231 PPrtllqltVWLAYSNSCLNPIIY 254
 
Name Accession Description Interval E-value
7tm_4 pfam13853
Olfactory receptor; The members of this family are transmembrane olfactory receptors.
72-258 5.68e-06

Olfactory receptor; The members of this family are transmembrane olfactory receptors.


Pssm-ID: 290564  Cd Length: 280  Bit Score: 46.33  E-value: 5.68e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701   72 FGALWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVVLQFTTGRWTLGSAMCKVVRYFQYLTPGV 151
Cdd:pfam13853   1 FCLIYLIIFLGNCTILHVIRTESSLHQPMYLFLAMLALIDLGLSASTLPTVLGIFLFGLREISLEACLAQMFFIHKFSFM 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  152 QIYVLLSICIDRFYTIVYPLSFK--VSREKAKKMIAASWILDAAFVTPVFF------FYGSNWDSHcNYFLPPSWEGTAY 223
Cdd:pfam13853  81 ESAVLLAMAFDRFVAICSPLRYSsiLTNPVISRIGLGILVRSFILILPLIFllkrlpFCGHHVLSH-SYCLHQGLIRLSC 159
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
gi 266457701  224 TVIHF---------LVGFVIPSILIILFYQKVIKYIWRIGT-DGR 258
Cdd:pfam13853 160 ADIKVnsiyglfvvISTLGLDSLLILISYGLILHTVLGIASrEER 204
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
82-330 7.43e-42

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431 [Multi-domain]  Cd Length: 254  Bit Score: 149.38  E-value: 7.43e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701   82 GNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVVLQFTTGRWTLGSAMCKVVRYFQYLTPGVQIYVLLSICI 161
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLLTLPFWLVYALFGTWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  162 DRFYTIVYPLSFKVSREKAKKMIAASWILDAAFVTPVFFFYGSNWDSH-----CNYFLPPSWEGTAYTVIHFLVGFVIPS 236
Cdd:pfam00001  81 DRYLAIVHPLRYRRIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIPSngvtsCLITFPESLWPVSYLLFSTVVGFLLPL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  237 ILIILFYqkvikyiWRIgtdGRTLRRTMNIVPR---TKVKTVKMFLLLNLVFLFSWLPFHVAQLWHPHEQDYKKSSLVFT 313
Cdd:pfam00001 161 LVILVCY-------TRI---IRTLRKQARSRRRsvrSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDLLIIISCVVT 230
                         250       260
                  ....*....|....*....|....
gi 266457701  314 AV-------TWVSFSSSASKPTLY 330
Cdd:pfam00001 231 PPrtllqltVWLAYSNSCLNPIIY 254
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
65-294 7.22e-12

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 64.80  E-value: 7.22e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  65 VATASIFFgalwlFSIFGNSLVcLVIHRSRRTQSTTNYFVVSMACADLLIsVASTPFVVLQFTTGRWTLGSAMCKVVRYF 144
Cdd:PHA03087  45 VVYSTIFF-----FGLVGNIIV-IYVLTKTKIKTPMDIYLLNLAVSDLLF-VMTLPFQIYYYILFQWSFGEFACKIVSGL 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701 145 QYLTPGVQIYVLLSICIDRFYTIVYPL-SFKVSREKAKKMIAAS-WILDAAFVTPVFFFYGSNWDSHCNYFLPPSWEGTA 222
Cdd:PHA03087 118 YYIGFYNSMNFITVMSVDRYIAIVHPVkSNKINTVKYGYIVSLViWIISIIETTPILFVYTTKKDHETLICCMFYNNKTM 197
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 266457701 223 Y--TVIHFLV---GFVIPSILIILFYQKVIKYIwrigtdgrtlrRTMNIVPRTKvKTVKMFLLLNLVFLFSWLPFHV 294
Cdd:PHA03087 198 NwkLFINFEIniiGMLIPLTILLYCYSKILITL-----------KGINKSKKNK-KAIKLVLIIVILFVIFWLPFNV 262
 
Name Accession Description Interval E-value
7tm_4 pfam13853
Olfactory receptor; The members of this family are transmembrane olfactory receptors.
72-258 5.68e-06

Olfactory receptor; The members of this family are transmembrane olfactory receptors.


Pssm-ID: 290564  Cd Length: 280  Bit Score: 46.33  E-value: 5.68e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701   72 FGALWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVVLQFTTGRWTLGSAMCKVVRYFQYLTPGV 151
Cdd:pfam13853   1 FCLIYLIIFLGNCTILHVIRTESSLHQPMYLFLAMLALIDLGLSASTLPTVLGIFLFGLREISLEACLAQMFFIHKFSFM 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  152 QIYVLLSICIDRFYTIVYPLSFK--VSREKAKKMIAASWILDAAFVTPVFF------FYGSNWDSHcNYFLPPSWEGTAY 223
Cdd:pfam13853  81 ESAVLLAMAFDRFVAICSPLRYSsiLTNPVISRIGLGILVRSFILILPLIFllkrlpFCGHHVLSH-SYCLHQGLIRLSC 159
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*
gi 266457701  224 TVIHF---------LVGFVIPSILIILFYQKVIKYIWRIGT-DGR 258
Cdd:pfam13853 160 ADIKVnsiyglfvvISTLGLDSLLILISYGLILHTVLGIASrEER 204
7TM_GPCR_Srsx pfam10320
Serpentine type 7TM GPCR chemoreceptor Srsx; Chemoreception is mediated in Caenorhabditis ...
78-265 6.79e-05

Serpentine type 7TM GPCR chemoreceptor Srsx; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srsx is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


Pssm-ID: 255903  Cd Length: 257  Bit Score: 42.97  E-value: 6.79e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701   78 FSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVVLQFTTGrwTLGSAMCkvvryFQYLTPGV-----Q 152
Cdd:pfam10320   3 IGLFGNVLMIHLTFRKKKLRSKCSILICVQCIAHLICLCGEIVFVVLLFTGT--QLTRNEC-----FWMISFYIfgqtaQ 75
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  153 IYVLLSICIDRFYTIVYPLSFkvsrekakKMIAASWILDAAFVTPV-----FFFYG-----SNWDSHCNYflPPSWEGTA 222
Cdd:pfam10320  76 GPLMLMIGIDRLIAVKFPIFY--------RLLSSSKYLFIQLIFPViyssfITVYGflqrdDETIIVCAP--PLALPGTA 145
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|...
gi 266457701  223 YTvIHFLVGFVIPSILIILFYQKVIKYIWRIGTDGRTLRRTMN 265
Cdd:pfam10320 146 FT-IFTLSSLFINVIVLIVYIILIIIFKNKKQSQNSDSKKVFK 187
7TM_GPCR_Srx pfam10328
Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis ...
77-218 8.62e-04

Serpentine type 7TM GPCR chemoreceptor Srx; Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srx is part of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.


Pssm-ID: 287318  Cd Length: 274  Bit Score: 39.49  E-value: 8.62e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701   77 LFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVAS----TPFVVLQFTTGRWTLGSAMCKVVRYFQYLTpGVQ 152
Cdd:pfam10328   5 LFGIILNWLIFYIFLKLPSLKNSFGILCANKAISNAIICTIFlfyvVPMTLLDLSFLPELLNSHIGGLVLLGLYEI-SPL 83
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 266457701  153 IYVLLSIciDRFYTIVYPLSF-KVSREKA-KKMIAASWILDAAFVTPVFFFYGsnwdshC-NYFLPPSW 218
Cdd:pfam10328  84 THLLISL--NRFCAVFFPFKYkKIFSIKNtKIIITIIWIISIIISTLFYLPLG------ChFYYSPETL 144
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
82-330 7.43e-42

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 278431 [Multi-domain]  Cd Length: 254  Bit Score: 149.38  E-value: 7.43e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701   82 GNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVVLQFTTGRWTLGSAMCKVVRYFQYLTPGVQIYVLLSICI 161
Cdd:pfam00001   1 GNLLVILVILRNKKLRTPTNIFLLNLAVADLLFLLLTLPFWLVYALFGTWPFGSALCKLVTALDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  162 DRFYTIVYPLSFKVSREKAKKMIAASWILDAAFVTPVFFFYGSNWDSH-----CNYFLPPSWEGTAYTVIHFLVGFVIPS 236
Cdd:pfam00001  81 DRYLAIVHPLRYRRIMRRAKAIILLIWVLALLLSLPPLLGWNTLDIPSngvtsCLITFPESLWPVSYLLFSTVVGFLLPL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  237 ILIILFYqkvikyiWRIgtdGRTLRRTMNIVPR---TKVKTVKMFLLLNLVFLFSWLPFHVAQLWHPHEQDYKKSSLVFT 313
Cdd:pfam00001 161 LVILVCY-------TRI---IRTLRKQARSRRRsvrSERKALKTLLVVVVVFILCWLPYHILNLLDSLCDLLIIISCVVT 230
                         250       260
                  ....*....|....*....|....
gi 266457701  314 AV-------TWVSFSSSASKPTLY 330
Cdd:pfam00001 231 PPrtllqltVWLAYSNSCLNPIIY 254
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
65-294 7.22e-12

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 64.80  E-value: 7.22e-12
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  65 VATASIFFgalwlFSIFGNSLVcLVIHRSRRTQSTTNYFVVSMACADLLIsVASTPFVVLQFTTGRWTLGSAMCKVVRYF 144
Cdd:PHA03087  45 VVYSTIFF-----FGLVGNIIV-IYVLTKTKIKTPMDIYLLNLAVSDLLF-VMTLPFQIYYYILFQWSFGEFACKIVSGL 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701 145 QYLTPGVQIYVLLSICIDRFYTIVYPL-SFKVSREKAKKMIAAS-WILDAAFVTPVFFFYGSNWDSHCNYFLPPSWEGTA 222
Cdd:PHA03087 118 YYIGFYNSMNFITVMSVDRYIAIVHPVkSNKINTVKYGYIVSLViWIISIIETTPILFVYTTKKDHETLICCMFYNNKTM 197
                        170       180       190       200       210       220       230
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 266457701 223 Y--TVIHFLV---GFVIPSILIILFYQKVIKYIwrigtdgrtlrRTMNIVPRTKvKTVKMFLLLNLVFLFSWLPFHV 294
Cdd:PHA03087 198 NwkLFINFEIniiGMLIPLTILLYCYSKILITL-----------KGINKSKKNK-KAIKLVLIIVILFVIFWLPFNV 262
PHA02638 PHA02638
CC chemokine receptor-like protein; Provisional
70-205 1.11e-10

CC chemokine receptor-like protein; Provisional


Pssm-ID: 165021 [Multi-domain]  Cd Length: 417  Bit Score: 61.57  E-value: 1.11e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  70 IFFGALWLFSIFGNSLVCLVIHrSRRTQSTTNYFVVSMACADLlISVASTPFVVLQfTTGRWTLGSAMCKVVRYFQYLTP 149
Cdd:PHA02638 103 IFYIIIFILGLFGNAAIIMILF-CKKIKTITDIYIFNLAISDL-IFVIDFPFIIYN-EFDQWIFGDFMCKVISASYYIGF 179
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 266457701 150 GVQIYVLLSICIDRFYTIVYPLSFKVSREKAKKMI--AASWILDAAFVTPVFFFYGSN 205
Cdd:PHA02638 180 FSNMFLITLMSIDRYFAILYPISFQKYRTFNIGIIlcIISWILSLIITSPAYFIFEAS 237
PHA02834 PHA02834
chemokine receptor-like protein; Provisional
70-346 3.09e-08

chemokine receptor-like protein; Provisional


Pssm-ID: 165177 [Multi-domain]  Cd Length: 323  Bit Score: 53.75  E-value: 3.09e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701  70 IFFGALWLFSIFGNSLVCLVIhRSRRTQSTTNYFVVSMACADLLIsVASTPFVVlQFTTGRWTLGSAMCKVVRYFQYLTP 149
Cdd:PHA02834  33 VFYILLFIFGLIGNVLVIAVL-IVKRFMFVVDVYLFNIAMSDLML-VFSFPFII-HNDLNEWIFGEFMCKLVLGVYFVGF 109
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701 150 GVQIYVLLSICIDRFYTIVYPLSFKVSREKAKKMIA-ASWILDAAFVTPVFFFYGSNWDSHCNYFLPPSWEG--TAYTVI 226
Cdd:PHA02834 110 FSNMFFVTLISIDRYILVVNATKIKNKSISLSVLLSvAAWVCSVILSMPAMVLYYVDNTDNLKQCIFNDYHEnfSWSAFF 189
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 266457701 227 HF---LVGFVIPSILIILFYQKVIKyiwrigtdgrTLRRTMNivpRTKVKTVKMFLLLNLVFLFSWLPFHVAQLWHPHEQ 303
Cdd:PHA02834 190 NFeinIFGIVIPLIILIYCYSKILY----------TLKNCKN---KNKTRSIKIILTVVTFTVVFWVPFNIVLFINSLQS 256
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|..
gi 266457701 304 ---------DYKKSSLVFTAVTWVSFSSSASKPTLYSIYNANFRRGMKETFC 346
Cdd:PHA02834 257 vglidigcyHFKKIVYSIDIAELISFVHCCVNPIIYAFVGKNFKKVFKNMFC 308
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH