NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|251823835|ref|NP_036055.2|]
View 

CD97 antigen isoform 1 precursor [Mus musculus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
214-246 1.46e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 52.25  E-value: 1.46e-08
                         10        20        30
                 ....*....|....*....|....*....|...
gi 251823835 214 DVDECSSGqHQCHNSTVCKNTVGSYKCHCRPGW 246
Cdd:cd00054    1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGY 32
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
69-103 3.47e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 42.24  E-value: 3.47e-05
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 251823835  69 DINECLLPGfSCGDFAMCKNSEGSYTCVCNLGYKL 103
Cdd:cd00054    1 DIDECASGN-PCQNGGTCVNTVGSYRCSCPPGYTG 34
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
165-197 3.67e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 42.24  E-value: 3.67e-05
                         10        20        30
                 ....*....|....*....|....*....|...
gi 251823835 165 DVNECISGqNHCHQSTHCINKLGGYSCICRQGW 197
Cdd:cd00054    1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGY 32
7tm_2 pfam00002
7 transmembrane receptor (Secretin family); This family is known as Family B, the ...
554-766 1.68e-71

7 transmembrane receptor (Secretin family); This family is known as Family B, the secretin-receptor family or family 2 of the G-protein-coupled receptors (GCPRs).They have been described in many animal species, but not in plants, fungi or prokaryotes. Three distinct sub-families are recognized. Subfamily B1 contains classical hormone receptors, such as receptors for secretin and glucagon, that are all involved in cAMP-mediated signalling pathways. Subfamily B2 contains receptors with long extracellular N-termini, such as the leukocyte cell-surface antigen CD97; calcium-independent receptors for latrotoxin, and brain-specific angiogenesis inhibitors amongst others. Subfamily B3 includes Methuselah and other Drosophila proteins. Other than the typical seven-transmembrane region, characteristic structural features include an amino-terminal extracellular domain involved in ligand binding, and an intracellular loop (IC3) required for specific G-protein coupling.


:

Pssm-ID: 249498  Cd Length: 239  Bit Score: 235.97  E-value: 1.68e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835  554 VKPIQSSRTMVHLHLCICLFLGSIIFLVGVENEGGEVGLR--CRLVAVMLHFCFLAAFCWMALEGVELYFLVVRVFQGQG 631
Cdd:pfam00002  29 FRKLRCTRNYIHLNLFASFILRAILFLVGDAVLFNKVGSDcvCKVVAVFLHYFFLANFFWMLVEGLYLYTLLVEVFFSER 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835  632 LSTWQRCLIGYGVPLLIVAISMAVVKmdGYGHATyCWLDFrKQGFLWSFSGPVAFIIFCNAAIFVITVWKLTKKFSeiNP 711
Cdd:pfam00002 109 KYLWWYLLIGWGVPAVVVGIWAIVRK--GYGNEG-CWLSN-NGGFWWIIKGPVLLVILVNFIFFINIVRILVQKLR--SP 182
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 251823835  712 NMKKLRKAR-VLTITSIAQLLVLGCTWGFGLFLFNPHST-WLSYIFTLLNCLQGLFL 766
Cdd:pfam00002 183 DMGETDQYRkRLAKSTLVLLPLLGITWVLFLFAPNDDVSvVFLYLFAILNSFQGFFV 239
GPS pfam01825
Latrophilin/CL-1-like GPS domain; Domain present in latrophilin/CL-1, sea urchin REJ and ...
479-519 6.98e-11

Latrophilin/CL-1-like GPS domain; Domain present in latrophilin/CL-1, sea urchin REJ and polycystin.


:

Pssm-ID: 250896  Cd Length: 43  Bit Score: 58.90  E-value: 6.98e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
gi 251823835  479 ELICAFWkaHNGNGYWDTDGCSMNGTG----FCHCNHLTSFAILM 519
Cdd:pfam01825   1 NPQCVFW--DEGTGGWSTDGCRVVSSNpthtVCSCNHLTSFAVLM 43
 
Name Accession Description Interval E-value
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
214-246 1.46e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 52.25  E-value: 1.46e-08
                         10        20        30
                 ....*....|....*....|....*....|...
gi 251823835 214 DVDECSSGqHQCHNSTVCKNTVGSYKCHCRPGW 246
Cdd:cd00054    1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGY 32
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
69-103 3.47e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 42.24  E-value: 3.47e-05
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 251823835  69 DINECLLPGfSCGDFAMCKNSEGSYTCVCNLGYKL 103
Cdd:cd00054    1 DIDECASGN-PCQNGGTCVNTVGSYRCSCPPGYTG 34
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
165-197 3.67e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 42.24  E-value: 3.67e-05
                         10        20        30
                 ....*....|....*....|....*....|...
gi 251823835 165 DVNECISGqNHCHQSTHCINKLGGYSCICRQGW 197
Cdd:cd00054    1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGY 32
7tm_2 pfam00002
7 transmembrane receptor (Secretin family); This family is known as Family B, the ...
554-766 1.68e-71

7 transmembrane receptor (Secretin family); This family is known as Family B, the secretin-receptor family or family 2 of the G-protein-coupled receptors (GCPRs).They have been described in many animal species, but not in plants, fungi or prokaryotes. Three distinct sub-families are recognized. Subfamily B1 contains classical hormone receptors, such as receptors for secretin and glucagon, that are all involved in cAMP-mediated signalling pathways. Subfamily B2 contains receptors with long extracellular N-termini, such as the leukocyte cell-surface antigen CD97; calcium-independent receptors for latrotoxin, and brain-specific angiogenesis inhibitors amongst others. Subfamily B3 includes Methuselah and other Drosophila proteins. Other than the typical seven-transmembrane region, characteristic structural features include an amino-terminal extracellular domain involved in ligand binding, and an intracellular loop (IC3) required for specific G-protein coupling.


Pssm-ID: 249498  Cd Length: 239  Bit Score: 235.97  E-value: 1.68e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835  554 VKPIQSSRTMVHLHLCICLFLGSIIFLVGVENEGGEVGLR--CRLVAVMLHFCFLAAFCWMALEGVELYFLVVRVFQGQG 631
Cdd:pfam00002  29 FRKLRCTRNYIHLNLFASFILRAILFLVGDAVLFNKVGSDcvCKVVAVFLHYFFLANFFWMLVEGLYLYTLLVEVFFSER 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835  632 LSTWQRCLIGYGVPLLIVAISMAVVKmdGYGHATyCWLDFrKQGFLWSFSGPVAFIIFCNAAIFVITVWKLTKKFSeiNP 711
Cdd:pfam00002 109 KYLWWYLLIGWGVPAVVVGIWAIVRK--GYGNEG-CWLSN-NGGFWWIIKGPVLLVILVNFIFFINIVRILVQKLR--SP 182
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 251823835  712 NMKKLRKAR-VLTITSIAQLLVLGCTWGFGLFLFNPHST-WLSYIFTLLNCLQGLFL 766
Cdd:pfam00002 183 DMGETDQYRkRLAKSTLVLLPLLGITWVLFLFAPNDDVSvVFLYLFAILNSFQGFFV 239
EGF_CA pfam07645
Calcium-binding EGF domain;
165-212 4.91e-12

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 62.36  E-value: 4.91e-12
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 251823835  165 DVNECISGQNHCHQSTHCINKLGGYSCICRQGWkpvpgsPNGPVSTVC 212
Cdd:pfam07645   1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGY------ENNEDGTNC 42
GPS pfam01825
Latrophilin/CL-1-like GPS domain; Domain present in latrophilin/CL-1, sea urchin REJ and ...
479-519 6.98e-11

Latrophilin/CL-1-like GPS domain; Domain present in latrophilin/CL-1, sea urchin REJ and polycystin.


Pssm-ID: 250896  Cd Length: 43  Bit Score: 58.90  E-value: 6.98e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
gi 251823835  479 ELICAFWkaHNGNGYWDTDGCSMNGTG----FCHCNHLTSFAILM 519
Cdd:pfam01825   1 NPQCVFW--DEGTGGWSTDGCRVVSSNpthtVCSCNHLTSFAVLM 43
EGF_CA pfam07645
Calcium-binding EGF domain;
214-248 2.19e-10

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 57.36  E-value: 2.19e-10
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 251823835  214 DVDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKP 248
Cdd:pfam07645   1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGYEN 35
EGF_CA smart00179
Calcium-binding EGF-like domain;
214-246 3.88e-09

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 53.79  E-value: 3.88e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 251823835   214 DVDECSSGqHQCHNSTVCKNTVGSYKCHCRPGW 246
Cdd:smart00179   1 DIDECASG-NPCQNGGTCVNTVGSYRCECPPGY 32
EGF_CA smart00179
Calcium-binding EGF-like domain;
165-197 3.62e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 45.32  E-value: 3.62e-06
                           10        20        30
                   ....*....|....*....|....*....|...
gi 251823835   165 DVNECISGqNHCHQSTHCINKLGGYSCICRQGW 197
Cdd:smart00179   1 DIDECASG-NPCQNGGTCVNTVGSYRCECPPGY 32
GPS smart00303
G-protein-coupled receptor proteolytic site domain; Present in latrophilin/CL-1, sea urchin ...
478-522 5.17e-06

G-protein-coupled receptor proteolytic site domain; Present in latrophilin/CL-1, sea urchin REJ and polycystin.


Pssm-ID: 197639  Cd Length: 49  Bit Score: 44.69  E-value: 5.17e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 251823835   478 HELICAFWKahNGNGYWDTDGCSM----NGTGFCHCNHLTSFAILMAQY 522
Cdd:smart00303   1 FNPICVFWD--ESSGEWSTRGCELletnGTHTTCSCNHLTTFAVLMDVP 47
EGF_CA smart00179
Calcium-binding EGF-like domain;
69-101 1.92e-05

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 43.00  E-value: 1.92e-05
                           10        20        30
                   ....*....|....*....|....*....|...
gi 251823835    69 DINECLLPGfSCGDFAMCKNSEGSYTCVCNLGY 101
Cdd:smart00179   1 DIDECASGN-PCQNGGTCVNTVGSYRCECPPGY 32
EGF_CA pfam07645
Calcium-binding EGF domain;
69-118 2.33e-05

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 42.72  E-value: 2.33e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 251823835   69 DINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYkllsgaesFVNESENTC 118
Cdd:pfam07645   1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGY--------ENNEDGTNC 42
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
568-774 3.41e-05

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 44.99  E-value: 3.41e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835  568 LCICLFLG--SIIFLVGVENEGGEVGlrCRLVAVMLHFCFLAAFCWMALEGVELYFLVVRVFQGQGLSTWQRCLIGY-GV 644
Cdd:pfam00001  25 LLFLLTLPpwALYYLVGGDWPFGDAL--CKLVGFLFVVNGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAKVLIlVV 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835  645 PLLIVAISMA-----VVKMDGYGHATYCWLDF-----RKQGFLWS----FSGPVAFIIFCNAAIFvITVWKLTKKFSEIN 710
Cdd:pfam00001 103 WVLALLLSLPpllfsWLRTVEEGNVTTCLIDFpeestLRSYTLLStllgFVLPLLVILVCYTLIL-RTLRKRARSGASQA 181
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 251823835  711 PNMKKLRKARVLTITSIAQLLVLGCTWgFGLFLFNPHSTW--LSYIFTLLNCLQglfLYVMLCLLN 774
Cdd:pfam00001 182 RAKRSSSKERKAAKMLLVVVVVFVLCW-LPYHIVLLLDSLcpLSIIRLLPTALL---ITLWLAYVN 243
MelB COG2211
Na+/melibiose symporter or related transporter [Carbohydrate transport and metabolism];
679-783 4.35e-03

Na+/melibiose symporter or related transporter [Carbohydrate transport and metabolism];


Pssm-ID: 225121 [Multi-domain]  Cd Length: 467  Bit Score: 39.15  E-value: 4.35e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835 679 SFSGPVAFIIFCNAAIFVITVWKLTKKFSeinpnmkklrKARVLTITSIaqLLVLGCtwgFGLFLFNPHSTWLSYIFTLL 758
Cdd:COG2211  272 LFAYLLLLASGAGLLIGLILWPRLVKKFG----------KKKLFLIGLL--LLAVGY---LLLYFTPAGSVVLIVVALII 336
                         90       100
                 ....*....|....*....|....*.
gi 251823835 759 NCL-QGLFLYVMLCLLNKKVREEYWK 783
Cdd:COG2211  337 AGVgTGIANPLPWAMVADTVDYGEWK 362
 
Name Accession Description Interval E-value
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
214-246 1.46e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 52.25  E-value: 1.46e-08
                         10        20        30
                 ....*....|....*....|....*....|...
gi 251823835 214 DVDECSSGqHQCHNSTVCKNTVGSYKCHCRPGW 246
Cdd:cd00054    1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGY 32
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
69-103 3.47e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 42.24  E-value: 3.47e-05
                         10        20        30
                 ....*....|....*....|....*....|....*
gi 251823835  69 DINECLLPGfSCGDFAMCKNSEGSYTCVCNLGYKL 103
Cdd:cd00054    1 DIDECASGN-PCQNGGTCVNTVGSYRCSCPPGYTG 34
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
165-197 3.67e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 42.24  E-value: 3.67e-05
                         10        20        30
                 ....*....|....*....|....*....|...
gi 251823835 165 DVNECISGqNHCHQSTHCINKLGGYSCICRQGW 197
Cdd:cd00054    1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGY 32
7tm_2 pfam00002
7 transmembrane receptor (Secretin family); This family is known as Family B, the ...
554-766 1.68e-71

7 transmembrane receptor (Secretin family); This family is known as Family B, the secretin-receptor family or family 2 of the G-protein-coupled receptors (GCPRs).They have been described in many animal species, but not in plants, fungi or prokaryotes. Three distinct sub-families are recognized. Subfamily B1 contains classical hormone receptors, such as receptors for secretin and glucagon, that are all involved in cAMP-mediated signalling pathways. Subfamily B2 contains receptors with long extracellular N-termini, such as the leukocyte cell-surface antigen CD97; calcium-independent receptors for latrotoxin, and brain-specific angiogenesis inhibitors amongst others. Subfamily B3 includes Methuselah and other Drosophila proteins. Other than the typical seven-transmembrane region, characteristic structural features include an amino-terminal extracellular domain involved in ligand binding, and an intracellular loop (IC3) required for specific G-protein coupling.


Pssm-ID: 249498  Cd Length: 239  Bit Score: 235.97  E-value: 1.68e-71
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835  554 VKPIQSSRTMVHLHLCICLFLGSIIFLVGVENEGGEVGLR--CRLVAVMLHFCFLAAFCWMALEGVELYFLVVRVFQGQG 631
Cdd:pfam00002  29 FRKLRCTRNYIHLNLFASFILRAILFLVGDAVLFNKVGSDcvCKVVAVFLHYFFLANFFWMLVEGLYLYTLLVEVFFSER 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835  632 LSTWQRCLIGYGVPLLIVAISMAVVKmdGYGHATyCWLDFrKQGFLWSFSGPVAFIIFCNAAIFVITVWKLTKKFSeiNP 711
Cdd:pfam00002 109 KYLWWYLLIGWGVPAVVVGIWAIVRK--GYGNEG-CWLSN-NGGFWWIIKGPVLLVILVNFIFFINIVRILVQKLR--SP 182
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*..
gi 251823835  712 NMKKLRKAR-VLTITSIAQLLVLGCTWGFGLFLFNPHST-WLSYIFTLLNCLQGLFL 766
Cdd:pfam00002 183 DMGETDQYRkRLAKSTLVLLPLLGITWVLFLFAPNDDVSvVFLYLFAILNSFQGFFV 239
EGF_CA pfam07645
Calcium-binding EGF domain;
165-212 4.91e-12

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 62.36  E-value: 4.91e-12
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*...
gi 251823835  165 DVNECISGQNHCHQSTHCINKLGGYSCICRQGWkpvpgsPNGPVSTVC 212
Cdd:pfam07645   1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGY------ENNEDGTNC 42
GPS pfam01825
Latrophilin/CL-1-like GPS domain; Domain present in latrophilin/CL-1, sea urchin REJ and ...
479-519 6.98e-11

Latrophilin/CL-1-like GPS domain; Domain present in latrophilin/CL-1, sea urchin REJ and polycystin.


Pssm-ID: 250896  Cd Length: 43  Bit Score: 58.90  E-value: 6.98e-11
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*
gi 251823835  479 ELICAFWkaHNGNGYWDTDGCSMNGTG----FCHCNHLTSFAILM 519
Cdd:pfam01825   1 NPQCVFW--DEGTGGWSTDGCRVVSSNpthtVCSCNHLTSFAVLM 43
EGF_CA pfam07645
Calcium-binding EGF domain;
214-248 2.19e-10

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 57.36  E-value: 2.19e-10
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 251823835  214 DVDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKP 248
Cdd:pfam07645   1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGYEN 35
EGF_CA smart00179
Calcium-binding EGF-like domain;
214-246 3.88e-09

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 53.79  E-value: 3.88e-09
                           10        20        30
                   ....*....|....*....|....*....|...
gi 251823835   214 DVDECSSGqHQCHNSTVCKNTVGSYKCHCRPGW 246
Cdd:smart00179   1 DIDECASG-NPCQNGGTCVNTVGSYRCECPPGY 32
EGF_CA smart00179
Calcium-binding EGF-like domain;
165-197 3.62e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 45.32  E-value: 3.62e-06
                           10        20        30
                   ....*....|....*....|....*....|...
gi 251823835   165 DVNECISGqNHCHQSTHCINKLGGYSCICRQGW 197
Cdd:smart00179   1 DIDECASG-NPCQNGGTCVNTVGSYRCECPPGY 32
GPS smart00303
G-protein-coupled receptor proteolytic site domain; Present in latrophilin/CL-1, sea urchin ...
478-522 5.17e-06

G-protein-coupled receptor proteolytic site domain; Present in latrophilin/CL-1, sea urchin REJ and polycystin.


Pssm-ID: 197639  Cd Length: 49  Bit Score: 44.69  E-value: 5.17e-06
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*....
gi 251823835   478 HELICAFWKahNGNGYWDTDGCSM----NGTGFCHCNHLTSFAILMAQY 522
Cdd:smart00303   1 FNPICVFWD--ESSGEWSTRGCELletnGTHTTCSCNHLTTFAVLMDVP 47
EGF_CA smart00179
Calcium-binding EGF-like domain;
69-101 1.92e-05

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 43.00  E-value: 1.92e-05
                           10        20        30
                   ....*....|....*....|....*....|...
gi 251823835    69 DINECLLPGfSCGDFAMCKNSEGSYTCVCNLGY 101
Cdd:smart00179   1 DIDECASGN-PCQNGGTCVNTVGSYRCECPPGY 32
EGF_CA pfam07645
Calcium-binding EGF domain;
69-118 2.33e-05

Calcium-binding EGF domain;


Pssm-ID: 254326  Cd Length: 42  Bit Score: 42.72  E-value: 2.33e-05
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 251823835   69 DINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYkllsgaesFVNESENTC 118
Cdd:pfam07645   1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGY--------ENNEDGTNC 42
ABC2_membrane_4 pfam12730
ABC-2 family transporter protein; This family is related to the ABC-2 membrane transporter ...
639-773 1.23e-04

ABC-2 family transporter protein; This family is related to the ABC-2 membrane transporter family pfam01061.


Pssm-ID: 257255  Cd Length: 230  Bit Score: 43.13  E-value: 1.23e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835  639 LIGYGVPLLIVAISMAVVKMDGYGHATYCWLDFRKQGFLWSFSGPVAFIIFCnaAIFVIT-----VWKLTkkFSeINPNM 713
Cdd:pfam12730  14 LLLLILPLLLALLALLLFGLNIGTLLSSSSLLLSSFSFLLALFLPLLIAILA--SLLVSRefkngTIKLL--LS-LPISR 88
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 251823835  714 KKLRKARVLT---ITSIAQLLVLGCTWGFGLFLFNPHSTWLSYIFTLLNCLQGLFLYVMLCLL 773
Cdd:pfam12730  89 KKIFLAKLLVlliLSLLASLLLLLLSLIAGLLLGGSGFSLSLLLGALLLLLLLSLLALLLILL 151
EGF cd00053
Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large ...
217-246 1.44e-04

Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.


Pssm-ID: 238010  Cd Length: 36  Bit Score: 40.54  E-value: 1.44e-04
                         10        20        30
                 ....*....|....*....|....*....|
gi 251823835 217 ECSSgQHQCHNSTVCKNTVGSYKCHCRPGW 246
Cdd:cd00053    1 ECAA-SNPCSNGGTCVNTPGSYRCVCPPGY 29
EGF_3 pfam12947
EGF domain; This family includes a variety of EGF-like domain homologues. This family includes ...
218-245 4.40e-04

EGF domain; This family includes a variety of EGF-like domain homologues. This family includes the C-terminal domain of the malaria parasite MSP1 protein.


Pssm-ID: 257421  Cd Length: 36  Bit Score: 39.06  E-value: 4.40e-04
                          10        20
                  ....*....|....*....|....*...
gi 251823835  218 CSSGQHQCHNSTVCKNTVGSYKCHCRPG 245
Cdd:pfam12947   1 CSENNGGCHPNATCTNTGGSFTCTCKSG 28
EGF smart00181
Epidermal growth factor-like domain;
217-247 2.50e-03

Epidermal growth factor-like domain;


Pssm-ID: 214544  Cd Length: 35  Bit Score: 36.73  E-value: 2.50e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 251823835   217 ECSSGqHQCHNSTvCKNTVGSYKCHCRPGWK 247
Cdd:smart00181   1 ECASG-GPCSNGT-CINTPGSYTCSCPPGYT 29
Acyl_transf_3 pfam01757
Acyltransferase family; This family includes a range of acyltransferase enzymes. This domain ...
602-794 7.89e-03

Acyltransferase family; This family includes a range of acyltransferase enzymes. This domain is found in many as yet uncharacterized C. elegans proteins and it is approximately 300 amino acids long.


Pssm-ID: 250841  Cd Length: 321  Bit Score: 37.88  E-value: 7.89e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835  602 HFCFLAAFCWMALegveLYFLVVRVFQGQGLSTWQRCLIGYGVPLLIVaismavvkmdgyghatycwldfrkQGFLWSFS 681
Cdd:pfam01757 122 HLWFLPALFVFYL----LLPLLLRLLRKLKLLLLLLLLALLLLLSLLY------------------------ILILLVGL 173
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835  682 GPVAFIIFCNAAIFVITVWkLTKKFSEINPNMKKLRKARVLtitsiaqLLVLGCTWGFGLFLFNPHSTWLSYIFTLLNCL 761
Cdd:pfam01757 174 PPWVLNLGIYLPFFLLGAL-LARYRKRIRSKRLLLLIVILL-------ALALLALFLLLLFLFGLLAPELYGIPSLLLLL 245
                         170       180       190
                  ....*....|....*....|....*....|...
gi 251823835  762 QGLFLYVMLCLLNKKVREeyWKWACMVTGSKYT 794
Cdd:pfam01757 246 LGVFLLLLLALLLGNLRS--LRNRLLSYLGKYS 276
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
568-774 3.41e-05

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 249497 [Multi-domain]  Cd Length: 251  Bit Score: 44.99  E-value: 3.41e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835  568 LCICLFLG--SIIFLVGVENEGGEVGlrCRLVAVMLHFCFLAAFCWMALEGVELYFLVVRVFQGQGLSTWQRCLIGY-GV 644
Cdd:pfam00001  25 LLFLLTLPpwALYYLVGGDWPFGDAL--CKLVGFLFVVNGYASILLLTAISIDRYLAIVHPLRYRRIRTPRRAKVLIlVV 102
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835  645 PLLIVAISMA-----VVKMDGYGHATYCWLDF-----RKQGFLWS----FSGPVAFIIFCNAAIFvITVWKLTKKFSEIN 710
Cdd:pfam00001 103 WVLALLLSLPpllfsWLRTVEEGNVTTCLIDFpeestLRSYTLLStllgFVLPLLVILVCYTLIL-RTLRKRARSGASQA 181
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 251823835  711 PNMKKLRKARVLTITSIAQLLVLGCTWgFGLFLFNPHSTW--LSYIFTLLNCLQglfLYVMLCLLN 774
Cdd:pfam00001 182 RAKRSSSKERKAAKMLLVVVVVFVLCW-LPYHIVLLLDSLcpLSIIRLLPTALL---ITLWLAYVN 243
MelB COG2211
Na+/melibiose symporter or related transporter [Carbohydrate transport and metabolism];
679-783 4.35e-03

Na+/melibiose symporter or related transporter [Carbohydrate transport and metabolism];


Pssm-ID: 225121 [Multi-domain]  Cd Length: 467  Bit Score: 39.15  E-value: 4.35e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 251823835 679 SFSGPVAFIIFCNAAIFVITVWKLTKKFSeinpnmkklrKARVLTITSIaqLLVLGCtwgFGLFLFNPHSTWLSYIFTLL 758
Cdd:COG2211  272 LFAYLLLLASGAGLLIGLILWPRLVKKFG----------KKKLFLIGLL--LLAVGY---LLLYFTPAGSVVLIVVALII 336
                         90       100
                 ....*....|....*....|....*.
gi 251823835 759 NCL-QGLFLYVMLCLLNKKVREEYWK 783
Cdd:COG2211  337 AGVgTGIANPLPWAMVADTVDYGEWK 362
Plasmod_Pvs28 pfam06247
Plasmodium ookinete surface protein Pvs28; This family consists of several ookinete surface ...
47-106 9.70e-03

Plasmodium ookinete surface protein Pvs28; This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium. Pvs25 and Pvs28 are expressed on the surface of ookinetes. These proteins are potential candidates for vaccine and induce antibodies that block the infectivity of Plasmodium vivax in immunised animals.


Pssm-ID: 253638 [Multi-domain]  Cd Length: 196  Bit Score: 37.03  E-value: 9.70e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 251823835   47 CVCKPGFSSEKElitnpaESCEDINECLLP---GFSCGDFAMC-----KNSEGSYTCVCNLGYKLLSG 106
Cdd:pfam06247  22 CKCNEGYVLKNE------NTCEEKVKCDKLenvNKVCGEYATCinqanKAEEKALKCGCINGYTLSQG 83
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH