NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|24987575|pdb|1LFLD| ]
View 

Chain D, Deoxy Hemoglobin (90% Relative Humidity)

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Hb-beta_like cd08925
Hemoglobin beta, gamma, delta, epsilon, and related Hb subunits; Hb is the oxygen transport ...
6-145 1.02e-84

Hemoglobin beta, gamma, delta, epsilon, and related Hb subunits; Hb is the oxygen transport protein of erythrocytes. It is an allosterically modulated heterotetramer. Hemoglobin A (HbA) is the most common Hb in adult humans, and is formed from two alpha-chains and two beta-chains (alpha2beta2). An equilibrium exists between deoxygenated/unliganded/T(tense state) Hb having low oxygen affinity, and oxygenated /liganded/R(relaxed state) Hb having a high oxygen affinity. Various endogenous heterotropic effectors bind Hb to modulate its oxygen affinity and cooperative behavior, e.g. hydrogen ions, chloride ions, carbon dioxide and 2,3-bisphosphoglycerate. Hb is also an allosterically regulated nitrite reductase; the plasma nitrite anion may be activated by hemoglobin in areas of hypoxia to bring about vasodilation. Other Hb types are: HbA2 (alpha2delta2) which in normal individuals, is naturally expressed at a low level; Hb Portland-1 (zeta2gamma2), Hb Gower-1 (zeta2epsilon2), and Hb Gower-2 (alpha2epsilon2), which are Hbs present during the embryonic period; and fetal hemoglobin (HbF, alpha2gamma2), the primary hemoglobin throughout most of gestation. These Hbs types have differences in O2 affinity and in their interactions with allosteric effectors.


:

Pssm-ID: 271276  Cd Length: 140  Bit Score: 247.17  E-value: 1.02e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD         6 EEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTF 85
Cdd:cd08925   1 EEKAEITAVWGKVDVDEIGAKALERLLIVYPWTQRYFSSFGDLSSAAAIMGNPKVAAHGKKVVGALGEAVKHLDDIKATF 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD        86 ATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 145
Cdd:cd08925  81 ADLSKKHSDKLHVDPENFKLLGDCLVVELAAHLGKEFTPEVQAAWEKFFAVVADALSRQY 140
 
Name Accession Description Interval E-value
Hb-beta_like cd08925
Hemoglobin beta, gamma, delta, epsilon, and related Hb subunits; Hb is the oxygen transport ...
6-145 1.02e-84

Hemoglobin beta, gamma, delta, epsilon, and related Hb subunits; Hb is the oxygen transport protein of erythrocytes. It is an allosterically modulated heterotetramer. Hemoglobin A (HbA) is the most common Hb in adult humans, and is formed from two alpha-chains and two beta-chains (alpha2beta2). An equilibrium exists between deoxygenated/unliganded/T(tense state) Hb having low oxygen affinity, and oxygenated /liganded/R(relaxed state) Hb having a high oxygen affinity. Various endogenous heterotropic effectors bind Hb to modulate its oxygen affinity and cooperative behavior, e.g. hydrogen ions, chloride ions, carbon dioxide and 2,3-bisphosphoglycerate. Hb is also an allosterically regulated nitrite reductase; the plasma nitrite anion may be activated by hemoglobin in areas of hypoxia to bring about vasodilation. Other Hb types are: HbA2 (alpha2delta2) which in normal individuals, is naturally expressed at a low level; Hb Portland-1 (zeta2gamma2), Hb Gower-1 (zeta2epsilon2), and Hb Gower-2 (alpha2epsilon2), which are Hbs present during the embryonic period; and fetal hemoglobin (HbF, alpha2gamma2), the primary hemoglobin throughout most of gestation. These Hbs types have differences in O2 affinity and in their interactions with allosteric effectors.


Pssm-ID: 271276  Cd Length: 140  Bit Score: 247.17  E-value: 1.02e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD         6 EEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTF 85
Cdd:cd08925   1 EEKAEITAVWGKVDVDEIGAKALERLLIVYPWTQRYFSSFGDLSSAAAIMGNPKVAAHGKKVVGALGEAVKHLDDIKATF 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD        86 ATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 145
Cdd:cd08925  81 ADLSKKHSDKLHVDPENFKLLGDCLVVELAAHLGKEFTPEVQAAWEKFFAVVADALSRQY 140
Globin pfam00042
Globin;
7-111 8.60e-34

Globin;


Pssm-ID: 249534  Cd Length: 108  Bit Score: 116.25  E-value: 8.60e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD           7 EKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTpdAVMGNPKVKAHGKKVLGAFSDGLAHLDN---L 81
Cdd:pfam00042   1 DKALVKASWGKVkgNAPELGAEILARLFTAYPDTKTYFPRFGDLST--AIKGSPKFKAHGKKVLAALGEAIKHLDDdgaL 78
                          90       100       110
                  ....*....|....*....|....*....|
1LFLD          82 KGTFATLSELHCDKLHVDPENFRLLGNVLV 111
Cdd:pfam00042  79 KAALKKLAARHAERGHVDPANFKLFGEALL 108
 
Name Accession Description Interval E-value
Hb-beta_like cd08925
Hemoglobin beta, gamma, delta, epsilon, and related Hb subunits; Hb is the oxygen transport ...
6-145 1.02e-84

Hemoglobin beta, gamma, delta, epsilon, and related Hb subunits; Hb is the oxygen transport protein of erythrocytes. It is an allosterically modulated heterotetramer. Hemoglobin A (HbA) is the most common Hb in adult humans, and is formed from two alpha-chains and two beta-chains (alpha2beta2). An equilibrium exists between deoxygenated/unliganded/T(tense state) Hb having low oxygen affinity, and oxygenated /liganded/R(relaxed state) Hb having a high oxygen affinity. Various endogenous heterotropic effectors bind Hb to modulate its oxygen affinity and cooperative behavior, e.g. hydrogen ions, chloride ions, carbon dioxide and 2,3-bisphosphoglycerate. Hb is also an allosterically regulated nitrite reductase; the plasma nitrite anion may be activated by hemoglobin in areas of hypoxia to bring about vasodilation. Other Hb types are: HbA2 (alpha2delta2) which in normal individuals, is naturally expressed at a low level; Hb Portland-1 (zeta2gamma2), Hb Gower-1 (zeta2epsilon2), and Hb Gower-2 (alpha2epsilon2), which are Hbs present during the embryonic period; and fetal hemoglobin (HbF, alpha2gamma2), the primary hemoglobin throughout most of gestation. These Hbs types have differences in O2 affinity and in their interactions with allosteric effectors.


Pssm-ID: 271276  Cd Length: 140  Bit Score: 247.17  E-value: 1.02e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD         6 EEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTF 85
Cdd:cd08925   1 EEKAEITAVWGKVDVDEIGAKALERLLIVYPWTQRYFSSFGDLSSAAAIMGNPKVAAHGKKVVGALGEAVKHLDDIKATF 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD        86 ATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 145
Cdd:cd08925  81 ADLSKKHSDKLHVDPENFKLLGDCLVVELAAHLGKEFTPEVQAAWEKFFAVVADALSRQY 140
Hb cd14765
Hemoglobins; Hb is the oxygen transport protein of erythrocytes. It is an allosterically ...
6-145 1.47e-76

Hemoglobins; Hb is the oxygen transport protein of erythrocytes. It is an allosterically modulated heterotetramer. Hemoglobin A (HbA) is the most common Hb in adult humans, and is formed from two alpha-chains and two beta-chains (alpha2beta2). An equilibrium exists between deoxygenated/unliganded/T(tense state) Hb having low oxygen affinity, and oxygenated /liganded/R(relaxed state) Hb having a high oxygen affinity. Various endogenous heterotropic effectors bind Hb to modulate its oxygen affinity and cooperative behavior, e.g. hydrogen ions, chloride ions, carbon dioxide and 2,3-bisphosphoglycerate. Hb is also an allosterically regulated nitrite reductase; the plasma nitrite anion may be activated by hemoglobin in areas of hypoxia to bring about vasodilation. Other Hb types are: HbA2 (alpha2delta2) which, in normal individuals, is naturally expressed at a low level; Hb Portland-1 (zeta2gamma2), Hb Gower-1 (zeta2epsilon2), and Hb Gower-2 (alpha2epsilon2), which are Hbs present during the embryonic period; and fetal hemoglobin (HbF, alpha2gamma2), the primary Hb throughout most of gestation. These Hb types have differences in O2 affinity and in their interactions with allosteric effectors.


Pssm-ID: 271298  Cd Length: 134  Bit Score: 226.08  E-value: 1.47e-76
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD         6 EEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLStpdavmGNPKVKAHGKKVLGAFSDGLAHLDNLKGTF 85
Cdd:cd14765   1 EEKSTIKALWGKVNVEEIGAEALARLFVVYPWTKRYFPKFDLSS------GNPKVKAHGKKVLGALGDAVKHLDDLKATF 74
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD        86 ATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 145
Cdd:cd14765  75 SNLSELHADKLHVDPENFKLLSDCLIVTLAAHLGKEFTPEVHAAWDKFLAVVADALSSKY 134
Hb-alpha_like cd08927
Hemoglobin alpha, zeta, mu, theta, and related Hb subunits; Hb is the oxygen transport protein ...
3-145 7.15e-44

Hemoglobin alpha, zeta, mu, theta, and related Hb subunits; Hb is the oxygen transport protein of erythrocytes. It is an allosterically modulated heterotetramer. Hemoglobin A (HbA) is the most common Hb in adult humans, and is formed from two alpha-chains and two beta-chains (alpha2beta2). An equilibrium exists between deoxygenated/unliganded/T(tense state) Hb having low oxygen affinity, and oxygenated /liganded/R(relaxed state) Hb having a high oxygen affinity. Various endogenous heterotropic effectors bind Hb to modulate its oxygen affinity and cooperative behavior, e.g. hydrogen ions, chloride ions, carbon dioxide and 2,3-bisphosphoglycerate. Hb is also an allosterically regulated nitrite reductase; the plasma nitrite anion may be activated by hemoglobin in areas of hypoxia to bring about vasodilation. Other Hb types are: HbA2 (alpha2delta2) which in normal individuals, is naturally expressed at a low level; Hb Portland-1 (zeta2gamma2), Hb Gower-1 (zeta2epsilon2), and Hb Gower-2 (alpha2epsilon2), which are Hbs present during the embryonic period; and fetal hemoglobin (HbF, alpha2gamma2), the primary hemoglobin throughout most of gestation. These Hbs types have differences in O2 affinity and in their interactions with allosteric effectors.


Pssm-ID: 271278  Cd Length: 140  Bit Score: 143.10  E-value: 7.15e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD         3 LTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFgDLSTpdavmGNPKVKAHGKKVLGAFSDGLAHLDN 80
Cdd:cd08927   1 LSAADKALIKALWGKIasHAEAIGAEALARMFLSYPQTKTYFPHF-DLSA-----GSAQVKAHGKKVMNALGDAVKHLDD 74
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
1LFLD        81 LKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 145
Cdd:cd08927  75 LPGALSKLSDLHAYKLRVDPVNFKLLSHCILVTLAAHLPEDFTPEVHCALDKFLSAVSLVLSSKY 139
Globin pfam00042
Globin;
7-111 8.60e-34

Globin;


Pssm-ID: 249534  Cd Length: 108  Bit Score: 116.25  E-value: 8.60e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD           7 EKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTpdAVMGNPKVKAHGKKVLGAFSDGLAHLDN---L 81
Cdd:pfam00042   1 DKALVKASWGKVkgNAPELGAEILARLFTAYPDTKTYFPRFGDLST--AIKGSPKFKAHGKKVLAALGEAIKHLDDdgaL 78
                          90       100       110
                  ....*....|....*....|....*....|
1LFLD          82 KGTFATLSELHCDKLHVDPENFRLLGNVLV 111
Cdd:pfam00042  79 KAALKKLAARHAERGHVDPANFKLFGEALL 108
Mb_like cd01040
myoglobin_like; M family globin domain; This family includes chimeric (FHbs/flavohemoglobins) ...
11-141 2.71e-20

myoglobin_like; M family globin domain; This family includes chimeric (FHbs/flavohemoglobins) and single-domain globins: FHbs, Ngbs/neuroglobins, Cygb/cytoglobins, GbE/avian eye specific globin E, GbX/globin X, amphibian GbY/globin Y, Mb/myoglobin, HbA/hemoglobin-alpha, HbB/hemoglobin-beta, SDgbs/single-domain globins related to FHbs, and Adgb/androglobin. The M family exhibits the canonical secondary structure of hemoglobins , a 3-over-3 alpha-helical sandwich structure (3/3 Mb-fold), built by eight alpha-helical segments (named A through H). In Adgbs, the globin domain is split into two: helices C-H are followed by helices A-B and the two parts are separated by the IQ motif. Although rearranged, the globin domain of most Adgbs contains a number of conserved residues which play critical roles in heme-coordination and gas ligand binding. Adgbs have been omitted from this A-H helix cd.


Pssm-ID: 271266  Cd Length: 132  Bit Score: 81.37  E-value: 2.71e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD        11 VTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDlstPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATL 88
Cdd:cd01040   1 VRSSWARVakDKDEFGVAFFARLFEANPELRKLFPKFAG---VDLDKGSPEFRAHAKRVVGALDSVVDNLDDPEALVALL 77
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*.
1LFLD        89 SEL---HCdKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANAL 141
Cdd:cd01040  78 RKLgrrHR-KRGVTPEHFDAFGEALLETLREVLGEAWTPEVEAAWRKLLDFIAAVM 132
Cygb cd08924
Cytoglobin and related globins; Cygb is a hexacoordinated heme-containing protein, able to ...
3-135 6.02e-20

Cytoglobin and related globins; Cygb is a hexacoordinated heme-containing protein, able to bind O2, NO and carbon monoxide. It has both nitric oxide dioxygenase and lipid peroxidase activities, and potentially participates in the maintenance of normal phenotype by implementing a homeostatic effect, to counteract stress conditions imposed on a cell. Cygb is implicated in multiple human pathologies: it is up-regulated in fibrosis and neurodegenerative disorders, and down-regulated in multiple cancer types, and may have a tumor suppressor role. It is expressed ubiquitously across a broad range of vertebrate organs including liver, heart, brain, lung, retina, and gut. In the human brain, it was detected at high levels in the habenula, hypothalamus, thalamus, hippocampus and pontine tegmental nuclei, detected at a low level in the cerebral cortex, and undetected in the cerebellar cortex.


Pssm-ID: 271275  Cd Length: 153  Bit Score: 81.04  E-value: 6.02e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD         3 LTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDN 80
Cdd:cd08924   1 LTEAERKVIQDTWARVyaNCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSSQLRKHARRVMGALNTVVENLHD 80
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*...
1LFLD        81 ---LKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVA 135
Cdd:cd08924  81 pdkVSSVLALVGKAHALKHKVEPVYFKILSGVILEVLAEEFAQDFTPEVQSAWSKLRG 138
Mb cd08926
Animal Myoglobins; Myoglobin (Mb) is a monomeric pentacoordinate heme-bound globin protein ...
10-145 1.63e-16

Animal Myoglobins; Myoglobin (Mb) is a monomeric pentacoordinate heme-bound globin protein whose expression has long been considered limited to cardiomyocytes and striated skeletal muscle cell, however it has recently been found localized in a wide variety of tissues including smooth muscle cells. As a physiological catalyst, it can modulate reactive oxygen species levels, facilitate oxygen diffusion within the cell, and scavenge or generate NO depending on oxygen tensions within the cell. Through its NO dioxygenase and nitrite reductase activities, Mb regulates mitochondrial function in energy-demanding tissues.


Pssm-ID: 271277  Cd Length: 148  Bit Score: 71.72  E-value: 1.63e-16
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD        10 AVTALWGKVNVD--EVGGEALGRLLVVYPWTQRFFESFGDLSTpDAVMGNPKVKAHGKKVLGAFSDGL----AHLDNLKg 83
Cdd:cd08926   5 LVLKVWAKVEADltGIGQEVLLRLFKEHPETQEHFPKFKGISQ-DDLKSNEDLKKHGVTVLTALGEILkqkgSHEAELK- 82
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|..
1LFLD        84 tfaTLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKY 145
Cdd:cd08926  83 ---PLAQTHATKHKIPPKYFELITEIIVKVLAEKHPSEMGAPAQAAFSKAFELICSDIEANY 141
CeGLB25_like cd14766
Caenorhabditis elegans globin GLB-25, and related globins; The C. elegans genome contains 33 ...
19-134 2.77e-07

Caenorhabditis elegans globin GLB-25, and related globins; The C. elegans genome contains 33 genes encoding globins that are all transcribed. These are very diverse in gene and protein structure and are localized in a variety of cells. The C. elegans globin GLB-25 (locus tag T06A1.3), like the majority of them, was expressed in neuronal cells in the head and tail portions of the body and in the nerve cord.


Pssm-ID: 271299  Cd Length: 136  Bit Score: 45.37  E-value: 2.77e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD        19 NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSEL---HCDK 95
Cdd:cd14766  11 KIDETGITMFLRLLTENPELLELFPKLKNLETEEALRSSEILENHAARVMDTLDEAISNIEDVDYVIDLLHKVgkmHAKK 90
                        90       100       110
                ....*....|....*....|....*....|....*....
1LFLD        96 LHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVV 134
Cdd:cd14766  91 PGFRPENFWKIEEPFLEAVKETLGDRYTDNMENIYRKTI 129
HGbI_like cd12131
Hell's gate globin I (HGbI) from Methylacidophilum infernorum and related proteins; HGbI ...
15-139 3.47e-06

Hell's gate globin I (HGbI) from Methylacidophilum infernorum and related proteins; HGbI is a single-domain heme-containing protein isolated from Methylacidiphilum infernorum, an aerobic acidophilic and thermophlic methanotroph. M. infernorum grows optimally at pH 2.0 and 60C and its home is New Zealands Hell's Gate geothermal park. The physiological role of HGbI has yet to be determined. It has an extremely strong resistance to auto-oxidation, and has fast oxygen-binding/slow release characteristics. Its CO on-rate is comparable to the O2 on-rate, and it is able to bind acetate with high affinity in the ferric state. The coordination of the heme iron changes in the ferrous form from pentacoordinate at low pH to predominantly hexacoordinate at high pH; in the ferric form, it is predominantly hexacoordinate at all pH.


Pssm-ID: 271286  Cd Length: 128  Bit Score: 42.15  E-value: 3.47e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD        15 WGKV--NVDEVGGEALGRLLVVYPWTQRFFESfGDLstpdavmgnpkvKAHGKKVLGAFSDGLAHLDNLKGTFATLSELH 92
Cdd:cd12131   9 FAKVepIADEAAALFYERLFELDPELRPLFKS-TDM------------EEQGKKLMATLVLVVKGLDDLETLVPALQDLG 75
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|.
1LFLD        93 cdKLHVD----PENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVAN 139
Cdd:cd12131  76 --RRHVKygvkPEHYPLVGEALLWTLEEGLGDEWTPEVKQAWTDAYGVLAG 124
GbX cd12137
Globin_X (GbX); Zebrafish globin X (GbX) is expressed at low levels in neurons of the central ...
3-135 4.82e-04

Globin_X (GbX); Zebrafish globin X (GbX) is expressed at low levels in neurons of the central nervous system, and appears to be associated with the sensory system. GbX is likely to be attached to the cell membrane via S-palmitoylation and N-myristoylation. It's unlikely to have a true respiratory function as it is membrane-associated. It has been suggested that it may protect the lipids in the cell membrane from oxidation or act as a redox-sensing or signaling protein. Zebrafish GbX is hexacoordinate, and displays cooperative O2 binding.


Pssm-ID: 271287  Cd Length: 145  Bit Score: 36.89  E-value: 4.82e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD         3 LTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMgNPKVKAHGKKVLGAFSDGLAHLDN 80
Cdd:cd12137   1 LTERQKQLIESSWSILqeDIAKVGVIMFVRLFETHPDCKDAFFPFRDVDLEDLRH-SKELRAHGLRVLSFVEKSLARLHQ 79
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*...
1LFLD        81 LKGTFATLSEL---HCdKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVA 135
Cdd:cd12137  80 PDKLEELLHELgrkHY-RYNAKVKYVDLVGQQFIFAIEPVLKEQWTPELEEAWKTLFR 136
FHb-globin cd08922
Globin domain of flavohemoglobins (flavoHbs); FlavoHbs function primarily as nitric oxide ...
3-141 5.18e-04

Globin domain of flavohemoglobins (flavoHbs); FlavoHbs function primarily as nitric oxide dioxygenases (NODs, EC 1.14.12.17), converting NO and O2 to inert NO3- (nitrate). They have an N-terminal globin domain and a C-terminal ferredoxin reductase-like NAD- and FAD-binding domain, and use the reducing power of cellular NAD(P)H to drive regeneration of the ferrous heme. They protect from nitrosative stress (the broad range of cellular toxicities caused by NO), and modulate NO signaling pathways. NO scavenging by flavoHb attenuates the expression of the nitrosative stress response, affects the swarming behavior of Escherichia coli, and maintains squid-Vibrio fischeri and Medicago truncatula-Sinorhizobium meliloti symbioses. FlavoHb expression affects Aspergillus nidulans sexual development and mycotoxin production, and Dictyostelium discoideum development. This family also includes some single-domain goblins (SDgbs).


Pssm-ID: 271273  Cd Length: 140  Bit Score: 36.73  E-value: 5.18e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD         3 LTPEEKSAVTALwgkVNVDEVGGEALG-----RLLVVYPWTQRFFESfgdlsTPDAVMGNPKVKAHgkkVLGAFSDGLAH 77
Cdd:cd08922   1 LTPEQIKIIKAT---APVLEEHGEEITtkfykRMFKEYPELKNLFNM-----TNQKLGRQPKALAF---AVLAYAKNIDD 69
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....
1LFLD        78 LDNLKGTFATLSELHCdKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANAL 141
Cdd:cd08922  70 LEPLLPAVERIAHKHV-SLQVKPEHYPIVGECLLEAIKEVLGDAATPEVLEAWTEAYGNLADIL 132
Ngb cd08920
Neuroglobins; The Ngb described in this subfamily is a hexacoordinate heme globin chiefly ...
49-141 4.79e-03

Neuroglobins; The Ngb described in this subfamily is a hexacoordinate heme globin chiefly expressed in neurons of the brain and retina. In the human brain, it is highly expressed in the hypothalamus, amygdala, and in the pontine tegmental nuclei. It affords protection of brain neurons from ischemia and hypoxia. In rats, it plays a role in the neuroprotection of limb ischemic preconditioning (LIP). It plays roles as: a sensor of oxygen levels; a store or reservoir for oxygen; a facilitator for oxygen transport; a regulator of ROS; and a scavenger of nitric oxide. It also functions in the protection against apoptosis and in sleep regulation. This subgroup contains Ngb from mammalian and non-mammalian vertebrates, including fish, amphibians and reptiles; the functionally pentacoordinated acoelomorph Symsagittifera roscoffensis Ngb does not belong to this subgroup.


Pssm-ID: 271272  Cd Length: 148  Bit Score: 34.04  E-value: 4.79e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1LFLD        49 STPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLkgtfATLSELHCD--KLH----VDPENFRLLGNVLVCVLAHHFGKEF 122
Cdd:cd08920  50 SSPQDCLSSPEFLDHIRKVMLVIDAAVSHLEDL----SSLEEYLTSlgRKHravgVKLESFSTVGESLLYMLESSLGPAF 125
                        90
                ....*....|....*....
1LFLD       123 TPPVQAAYQKVVAGVANAL 141
Cdd:cd08920 126 TPDTREAWSTLYGAVVQAM 144
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH