NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|24899633|ref|NP_705889|]
View 

solute carrier family 12 member 8 [Rattus norvegicus]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
2a30 TIGR00930
K-Cl cotransporter; [Transport and binding proteins, Other].
34-421 2.26e-74

K-Cl cotransporter; [Transport and binding proteins, Other].


:

Pssm-ID: 233194 [Multi-domain]  Cd Length: 953  Bit Score: 259.64  E-value: 2.26e-74
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633    34 EPVLFGTWDGVFTSCMINIFGVVLFLRTGWLVGNTGVLLGLLLVSFVILVALITVLSGIGVAEHGWMGSGGVYSMISSVL 113
Cdd:TIGR00930  74 GAVKFGWVMGVLVPCLLNIWGVILFLRLSWIVGQAGIGLSLLIILLCCCVTTITGLSMSAIATNGVVKGGGAYYLISRSL 153
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   114 GGQMGGTVGLLYVFGQCVAGAMYLTGFAESISDLL---GLG----NIWAVRGISVAVLLALLGINLAGVKWIIRLQLLLL 186
Cdd:TIGR00930 154 GPEFGGSIGLIFAFANAVAVAMYVVGFAETVLDLLrenGSKimvdPINDIRIYGTVTVVVLLGISFAGMEWENKAQVLFL 233
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   187 SLLAVSTLDFVVGSF--THLDPEHGFIGYSPELLQSNILPEYSPGES-FFTVFGVFFPAATGVMAGFNMGGDLREPADQh 263
Cdd:TIGR00930 234 VIVLLSILNIFVGTIipAFDKPAKGFFGLGNEIFSENFIPGIPGPEGgFFSLFGIFFPSVTGILAGANISGDLKDPQKA- 312
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   264 TPR--LPSSCWVSrgFSNIIFAFLLGAVCTREALRS-----------------------------DFLIAEKVSLVGFLF 312
Cdd:TIGR00930 313 IPKgtLLAILTTT--VVYLGSVVLFGACVVRDATGDkndtlvtnctsaacfsecahntcsyglmnNLQVMSLVSPFPPLI 390
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   313 LLGLYISSLASCMGGLYGAPRILQCIAQDKVIPALAFLGNGKGPNKTPVAAICLTSLVTMAFVLVGQVNVLAPVVTINFM 392
Cdd:TIGR00930 391 TAGIFSATLSSALASLVSAPRLFQALCKDNIYPFLQFFGKGYGKNGEPLRAYLLTAFIAEGFILIAELNTIAPIISNFFL 470
                         410       420
                  ....*....|....*....|....*....
gi 24899633   393 LTYIAVDYSYFalsmaHCGLAQSPEPMPR 421
Cdd:TIGR00930 471 ASYALINFSCF-----HASLLRSPGWRPR 494
 
Name Accession Description Interval E-value
2a30 TIGR00930
K-Cl cotransporter; [Transport and binding proteins, Other].
34-421 2.26e-74

K-Cl cotransporter; [Transport and binding proteins, Other].


Pssm-ID: 233194 [Multi-domain]  Cd Length: 953  Bit Score: 259.64  E-value: 2.26e-74
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633    34 EPVLFGTWDGVFTSCMINIFGVVLFLRTGWLVGNTGVLLGLLLVSFVILVALITVLSGIGVAEHGWMGSGGVYSMISSVL 113
Cdd:TIGR00930  74 GAVKFGWVMGVLVPCLLNIWGVILFLRLSWIVGQAGIGLSLLIILLCCCVTTITGLSMSAIATNGVVKGGGAYYLISRSL 153
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   114 GGQMGGTVGLLYVFGQCVAGAMYLTGFAESISDLL---GLG----NIWAVRGISVAVLLALLGINLAGVKWIIRLQLLLL 186
Cdd:TIGR00930 154 GPEFGGSIGLIFAFANAVAVAMYVVGFAETVLDLLrenGSKimvdPINDIRIYGTVTVVVLLGISFAGMEWENKAQVLFL 233
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   187 SLLAVSTLDFVVGSF--THLDPEHGFIGYSPELLQSNILPEYSPGES-FFTVFGVFFPAATGVMAGFNMGGDLREPADQh 263
Cdd:TIGR00930 234 VIVLLSILNIFVGTIipAFDKPAKGFFGLGNEIFSENFIPGIPGPEGgFFSLFGIFFPSVTGILAGANISGDLKDPQKA- 312
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   264 TPR--LPSSCWVSrgFSNIIFAFLLGAVCTREALRS-----------------------------DFLIAEKVSLVGFLF 312
Cdd:TIGR00930 313 IPKgtLLAILTTT--VVYLGSVVLFGACVVRDATGDkndtlvtnctsaacfsecahntcsyglmnNLQVMSLVSPFPPLI 390
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   313 LLGLYISSLASCMGGLYGAPRILQCIAQDKVIPALAFLGNGKGPNKTPVAAICLTSLVTMAFVLVGQVNVLAPVVTINFM 392
Cdd:TIGR00930 391 TAGIFSATLSSALASLVSAPRLFQALCKDNIYPFLQFFGKGYGKNGEPLRAYLLTAFIAEGFILIAELNTIAPIISNFFL 470
                         410       420
                  ....*....|....*....|....*....
gi 24899633   393 LTYIAVDYSYFalsmaHCGLAQSPEPMPR 421
Cdd:TIGR00930 471 ASYALINFSCF-----HASLLRSPGWRPR 494
AA_permease pfam00324
Amino acid permease;
43-398 6.20e-25

Amino acid permease;


Pssm-ID: 249769 [Multi-domain]  Cd Length: 472  Bit Score: 107.43  E-value: 6.20e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633    43 GVFTSCMINIFGVVLFLRTGWLVGNTGVLLGLLLVSFVILVALITVLSgigVAEHGWMG--SGGVYSMISSVLGGQMGGT 120
Cdd:pfam00324   1 HVLMIALGGVIGTGLFVGSGSVLGQAGPAGALLGYLISGVVIFLVMLS---LGEMSTNGpvAGGFYAYASRFLGPSLGFA 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   121 VGLLYVFGQC------VAGAMYLTGFAESISDLLGLGniwavrGISVAVLLALLGINLAGVKWIIRLQLLLLSLLAVSTL 194
Cdd:pfam00324  78 TGWNYWLSWItvlaleLTAASILIQFWELVPDIPYTW------GWGAVFIVLLLIINLVGVKGYGEAEFWFALIKVIAII 151
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   195 DFVVGSFTHL----DPEHG-FIGY--SPELLQSNILPEYSPGESFFTVFGVFFPAATGVMAGFNMGGDLREPAdQHTPRL 267
Cdd:pfam00324 152 AFIIVGVIILlsggGPNDGaYLGDngGKNNFPPGFAPGGGSFANFISVFVIAFFAFTGIELVGIAAGEVKNPE-KSIPKA 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   268 PSSCWVSRGFSNIIFAFLLGAVCTREALRSDFLIAEKVSLVGFLFLLGL------------YISSLASCMGGLYGAPRIL 335
Cdd:pfam00324 231 ILQVVWRITIFYILSLLAIGLLVPWNDPGLLADSASAASPFVIFFKSLGisglaplinaviLTAALSAANSSLYSGSRML 310
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 24899633   336 QCIAQDKVIPalaFLGNGKGPNKTPVAAICLTSLVTMAFVLvgqVNVLAPVVTINFMLTYIAV 398
Cdd:pfam00324 311 YALARDGLAP---KFLKKVDKSGVPLRAILLSTAISLLAVL---LASLNPAIVFNFLLAISGL 367
PotE COG0531
Amino acid transporters [Amino acid transport and metabolism]
43-405 9.15e-17

Amino acid transporters [Amino acid transport and metabolism]


Pssm-ID: 223605 [Multi-domain]  Cd Length: 466  Bit Score: 82.13  E-value: 9.15e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633  43 GVFTSCMINIFGVVLFlrTGWLVGNTGVLLGLLLVSFVILVALITV-LSGIGVAEHGWM--GSGGVYSMISSVLGGQMGG 119
Cdd:COG0531  15 GLFDLLTALGVGSMIG--SGIFALPGSAAGLAPAAILAWLIAGIIIlFLALSYAELSSAipSAGGAYAYAKRALGPRLGF 92
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633 120 TVGLLYVFGQCVAGAMYLTGFAESISDLLGLGNI-----WAVRGISVAVLLALLGINLAGVKWIIRLQLLLLSLLAVSTL 194
Cdd:COG0531  93 LAGWLYLLAYVIALAAIAIGAASYLSYLFPGPGLlsigpLLIILIALALIALLTLLNLRGIKASAKINSIITILKIIILL 172
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633 195 DFVVGSFTHLDPEHGfigyspeLLQSNILPEYSPGESFFTVFGVFFPAATGVMAGFNMGGDLREPAdqhtPRLPSSCWVS 274
Cdd:COG0531 173 IFIILGLFAFGFSNG-------NLFAPFNPGGGSFGGILAAILLAFFAFTGFEAIATLAEEVKNPK----RTIPRAIILS 241
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633 275 R---GFSNIIFAFLLGAVCTREALRSD------FLIAEKVSLVGFLF--LLGLYISSLASCMGGLYGAPRILQCIAQDKV 343
Cdd:COG0531 242 LlivLILYILGALVIVGVLPAGDLAASapsaplALAALFGGGNWGAIiiAILALLSLFGSLLAWILAVSRVLYAMARDGL 321
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 24899633 344 IPALAFLGNGKGpnKTPVAAICLTSLVTMAFVLVG-----QVNVLAPVVTINFMLTYIAVDYSYFAL 405
Cdd:COG0531 322 LPKFFAKVNPKG--RTPVIALILTGIISLILLLLFplssiAFNALVSLASVAFLIAYLLVALALLVL 386
 
Name Accession Description Interval E-value
2a30 TIGR00930
K-Cl cotransporter; [Transport and binding proteins, Other].
34-421 2.26e-74

K-Cl cotransporter; [Transport and binding proteins, Other].


Pssm-ID: 233194 [Multi-domain]  Cd Length: 953  Bit Score: 259.64  E-value: 2.26e-74
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633    34 EPVLFGTWDGVFTSCMINIFGVVLFLRTGWLVGNTGVLLGLLLVSFVILVALITVLSGIGVAEHGWMGSGGVYSMISSVL 113
Cdd:TIGR00930  74 GAVKFGWVMGVLVPCLLNIWGVILFLRLSWIVGQAGIGLSLLIILLCCCVTTITGLSMSAIATNGVVKGGGAYYLISRSL 153
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   114 GGQMGGTVGLLYVFGQCVAGAMYLTGFAESISDLL---GLG----NIWAVRGISVAVLLALLGINLAGVKWIIRLQLLLL 186
Cdd:TIGR00930 154 GPEFGGSIGLIFAFANAVAVAMYVVGFAETVLDLLrenGSKimvdPINDIRIYGTVTVVVLLGISFAGMEWENKAQVLFL 233
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   187 SLLAVSTLDFVVGSF--THLDPEHGFIGYSPELLQSNILPEYSPGES-FFTVFGVFFPAATGVMAGFNMGGDLREPADQh 263
Cdd:TIGR00930 234 VIVLLSILNIFVGTIipAFDKPAKGFFGLGNEIFSENFIPGIPGPEGgFFSLFGIFFPSVTGILAGANISGDLKDPQKA- 312
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   264 TPR--LPSSCWVSrgFSNIIFAFLLGAVCTREALRS-----------------------------DFLIAEKVSLVGFLF 312
Cdd:TIGR00930 313 IPKgtLLAILTTT--VVYLGSVVLFGACVVRDATGDkndtlvtnctsaacfsecahntcsyglmnNLQVMSLVSPFPPLI 390
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   313 LLGLYISSLASCMGGLYGAPRILQCIAQDKVIPALAFLGNGKGPNKTPVAAICLTSLVTMAFVLVGQVNVLAPVVTINFM 392
Cdd:TIGR00930 391 TAGIFSATLSSALASLVSAPRLFQALCKDNIYPFLQFFGKGYGKNGEPLRAYLLTAFIAEGFILIAELNTIAPIISNFFL 470
                         410       420
                  ....*....|....*....|....*....
gi 24899633   393 LTYIAVDYSYFalsmaHCGLAQSPEPMPR 421
Cdd:TIGR00930 471 ASYALINFSCF-----HASLLRSPGWRPR 494
AA_permease pfam00324
Amino acid permease;
43-398 6.20e-25

Amino acid permease;


Pssm-ID: 249769 [Multi-domain]  Cd Length: 472  Bit Score: 107.43  E-value: 6.20e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633    43 GVFTSCMINIFGVVLFLRTGWLVGNTGVLLGLLLVSFVILVALITVLSgigVAEHGWMG--SGGVYSMISSVLGGQMGGT 120
Cdd:pfam00324   1 HVLMIALGGVIGTGLFVGSGSVLGQAGPAGALLGYLISGVVIFLVMLS---LGEMSTNGpvAGGFYAYASRFLGPSLGFA 77
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   121 VGLLYVFGQC------VAGAMYLTGFAESISDLLGLGniwavrGISVAVLLALLGINLAGVKWIIRLQLLLLSLLAVSTL 194
Cdd:pfam00324  78 TGWNYWLSWItvlaleLTAASILIQFWELVPDIPYTW------GWGAVFIVLLLIINLVGVKGYGEAEFWFALIKVIAII 151
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   195 DFVVGSFTHL----DPEHG-FIGY--SPELLQSNILPEYSPGESFFTVFGVFFPAATGVMAGFNMGGDLREPAdQHTPRL 267
Cdd:pfam00324 152 AFIIVGVIILlsggGPNDGaYLGDngGKNNFPPGFAPGGGSFANFISVFVIAFFAFTGIELVGIAAGEVKNPE-KSIPKA 230
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   268 PSSCWVSRGFSNIIFAFLLGAVCTREALRSDFLIAEKVSLVGFLFLLGL------------YISSLASCMGGLYGAPRIL 335
Cdd:pfam00324 231 ILQVVWRITIFYILSLLAIGLLVPWNDPGLLADSASAASPFVIFFKSLGisglaplinaviLTAALSAANSSLYSGSRML 310
                         330       340       350       360       370       380
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 24899633   336 QCIAQDKVIPalaFLGNGKGPNKTPVAAICLTSLVTMAFVLvgqVNVLAPVVTINFMLTYIAV 398
Cdd:pfam00324 311 YALARDGLAP---KFLKKVDKSGVPLRAILLSTAISLLAVL---LASLNPAIVFNFLLAISGL 367
PotE COG0531
Amino acid transporters [Amino acid transport and metabolism]
43-405 9.15e-17

Amino acid transporters [Amino acid transport and metabolism]


Pssm-ID: 223605 [Multi-domain]  Cd Length: 466  Bit Score: 82.13  E-value: 9.15e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633  43 GVFTSCMINIFGVVLFlrTGWLVGNTGVLLGLLLVSFVILVALITV-LSGIGVAEHGWM--GSGGVYSMISSVLGGQMGG 119
Cdd:COG0531  15 GLFDLLTALGVGSMIG--SGIFALPGSAAGLAPAAILAWLIAGIIIlFLALSYAELSSAipSAGGAYAYAKRALGPRLGF 92
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633 120 TVGLLYVFGQCVAGAMYLTGFAESISDLLGLGNI-----WAVRGISVAVLLALLGINLAGVKWIIRLQLLLLSLLAVSTL 194
Cdd:COG0531  93 LAGWLYLLAYVIALAAIAIGAASYLSYLFPGPGLlsigpLLIILIALALIALLTLLNLRGIKASAKINSIITILKIIILL 172
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633 195 DFVVGSFTHLDPEHGfigyspeLLQSNILPEYSPGESFFTVFGVFFPAATGVMAGFNMGGDLREPAdqhtPRLPSSCWVS 274
Cdd:COG0531 173 IFIILGLFAFGFSNG-------NLFAPFNPGGGSFGGILAAILLAFFAFTGFEAIATLAEEVKNPK----RTIPRAIILS 241
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633 275 R---GFSNIIFAFLLGAVCTREALRSD------FLIAEKVSLVGFLF--LLGLYISSLASCMGGLYGAPRILQCIAQDKV 343
Cdd:COG0531 242 LlivLILYILGALVIVGVLPAGDLAASapsaplALAALFGGGNWGAIiiAILALLSLFGSLLAWILAVSRVLYAMARDGL 321
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 24899633 344 IPALAFLGNGKGpnKTPVAAICLTSLVTMAFVLVG-----QVNVLAPVVTINFMLTYIAVDYSYFAL 405
Cdd:COG0531 322 LPKFFAKVNPKG--RTPVIALILTGIISLILLLLFplssiAFNALVSLASVAFLIAYLLVALALLVL 386
AA_permease_2 pfam13520
Amino acid permease;
79-398 2.45e-11

Amino acid permease;


Pssm-ID: 257840 [Multi-domain]  Cd Length: 425  Bit Score: 65.03  E-value: 2.45e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633    79 FVILVALITVLSGIGV-AEHG--WMGSGGVYSMISSVLGGQMGGTVGLLYVFGQCVAGAMYLTGFAESISDLLGL---GN 152
Cdd:pfam13520  35 WGWIAALIFSLAVALVyAELSsaFPRNGGIYVWLKNAFGKPVAFIAAWFNWLAYILGLASSSSVAASYLLSAFGPdlvGN 114
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   153 IWAVRGISVAVLLALLGINLAGVKWIIRLQLLLLSLLAVSTLDFVVGSFTHLDPEHGFigYSPELLQSNILPEYSPGesF 232
Cdd:pfam13520 115 TWLTYGIAIAILIIFALINIRGIKESAKIQNILGIVKLLLPLILIILLGLVLASGGGF--NLLPNSWTTFFPSGWPG--V 190
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   233 FTVFGVFFPAATGVMAGFNMGGDLREPAdqhTPRLPSSCWVSRGFSNIIFAFLLGAVCTRE---ALRSDFLIAEKV---- 305
Cdd:pfam13520 191 FLGLLVVLWSFGGFESAANVSEEVKKRD---VPKALFIGLLIVGVLYLLVNILFLGVVPDDeiaKLNNLPSVAALLfeav 267
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   306 --SLVGFLFLLGLYISSLASCMGGLYGAPRILQCIAQDKVIPalAFLGNgKGPNKTPVAAICLTSLVTMAFVLV-----G 378
Cdd:pfam13520 268 ggPWGAIIVAILLALSLLGAVNTAIVASSRVLEALARDGVLP--KFFAK-VNKFGSPVRAIILTAILSLILLLLfllggA 344
                         330       340
                  ....*....|....*....|
gi 24899633   379 QVNVLAPVVTINFMLTYIAV 398
Cdd:pfam13520 345 AYNALLSLSAVGYLLVYLLL 364
2A0306 TIGR00909
amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines].
78-398 9.67e-04

amino acid transporter; [Transport and binding proteins, Amino acids, peptides and amines].


Pssm-ID: 129987 [Multi-domain]  Cd Length: 429  Bit Score: 40.89  E-value: 9.67e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633    78 SFVIlVALITVLSGIGVAEHGWM--GSGGVYSMISSVLGGQMGGTVGLLYVFGQCVAGAMYLTGFA---ESISDLLGL-- 150
Cdd:TIGR00909  41 SFVL-AGLTALFIALVYAELAAMlpVAGSPYTYAYEAMGELTAFIIGWSLWLEYGVAVAAVAVGWGgylQEFLPGVGLdl 119
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   151 --------GNIWAVRGISVAVLLALLGINLAGVKWIIRLQLLLLSLLAVSTLDFVVGSFTHLDPeHGFIGYSPELLQSni 222
Cdd:TIGR00909 120 pavltakpGNGGVFNLPALLIVLFLTYILYLGAKESGKVNDILVVLKVAALLLFAALGAIHFAS-NNYTPFMPMGFGG-- 196
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   223 lpeyspgesFFTVFGVFFPAATGVMAGFNMGGDLREPADQHTPRLPSSCWVSRGFSNIIFAFLLGAVCTR-----EALRS 297
Cdd:TIGR00909 197 ---------VGAATALVFFAFIGFEAISTAAEEVKNPERDIPKAIILSLIVVTLLYVLVAAVILGAVPWRqlagsTAPLS 267
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24899633   298 DFLIAEKVSLVGFLFLLGLYISSLASCMGGLYGAPRILQCIAQDKVIPalAFLGNGKGPNKTPVAAICLTSLVTMAFVLV 377
Cdd:TIGR00909 268 LVGYDLGQGIGGLILTAGAVFSIASVMLAGIYGTSRVLFAMSRDGLLP--GSLSKVHPKTGTPHMSIIIFSLTAALLASL 345
                         330       340
                  ....*....|....*....|.
gi 24899633   378 GQVNVLAPVVTINFMLTYIAV 398
Cdd:TIGR00909 346 VPLEGLAELTSIGTLIAFAAV 366
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.12
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH