NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|24584554|ref|NP_723953|]
View 

Ca[2+]-channel protein alpha[[1]] subunit D, isoform D [Drosophila melanogaster]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Ca_chan_IQ pfam08763
Voltage gated calcium channel IQ domain; Voltage gated calcium channels control cellular ...
2062-2092 1.37e-15

Voltage gated calcium channel IQ domain; Voltage gated calcium channels control cellular calcium entry in response to changes in membrane potential. The isoleucine-glutamine (IQ) motif in the voltage gated calcium channel IQ domain interacts with hydrophobic pockets of Ca2+/calmodulin. The interaction regulates two self-regulatory calcium dependent feedback mechanism, calcium dependent inactivation (CDI), and calcium-dependent facilitation (CDF).


:

Pssm-ID: 149732  Cd Length: 32  Bit Score: 73.77  E-value: 1.37e-15
                           10        20        30
                   ....*....|....*....|....*....|.
gi 24584554   2062 DEVTVGKFYATYLIQDYFRRFKKRKEQEGKE 2092
Cdd:pfam08763    1 DEVTVGKFYATFLIQDYFRQFKKRKEQEQQG 31
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
653-877 5.25e-52

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


:

Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 184.41  E-value: 5.25e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554    653 VEYVFLVIFTAECVMKILAYGFVLHngaYLRNGWNLLDFTIVVIGAISTALSQL-MKDAFDVKALRAFRVLRPLRLVSGV 731
Cdd:pfam00520    2 LDYVFTVIFTLEMLLKFIALGFKLS---YFRSPWNILDFLVVLPSLVSLILRLLgEGSEGLLSVLRLLRLLRLLRLLRRF 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554    732 PSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKacrdeitgeyeenirpcgvgyqcppgykCYGGWDG 811
Cdd:pfam00520   79 PGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDK----------------------------CEDENEN 130
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 24584554    812 PNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAmGSDWQWMYFISMVILGAFFVMNLILGVL 877
Cdd:pfam00520  131 PINGNSNFDSYPEALLWLFRTLTTEGWGDIMPDTLDA-GTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1698-1925 1.97e-49

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


:

Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 177.09  E-value: 1.97e-49
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1698 LNMIFTAVFALEFVFKLAAFRFK-NYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSqiaecdivegckstkksagsnli 1776
Cdd:pfam00520    2 LDYVFTVIFTLEMLLKFIALGFKlSYFRSPWNILDFLVVLPSLVSLILRLLGEGSEG----------------------- 58
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1777 SINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDGG----NAITANNNF 1852
Cdd:pfam00520   59 LLSVLRLLRLLRLLRLLRRFPGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEdeneNPINGNSNF 138
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 24584554   1853 QTFQQAVLVLFRSATGEAWQEIMMSCSAqpdvkcdmnsdtpgepCGSSIAYPYFISFYVLCSFLIINLFVAVI 1925
Cdd:pfam00520  139 DSYPEALLWLFRTLTTEGWGDIMPDTLD----------------AGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1019-1213 3.23e-48

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


:

Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 173.24  E-value: 3.23e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1019 YTNVFFIGLFTCEMLLKMYSLGF-QGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRS 1097
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGFkLSYFRSPWNILDFLVVLPSLVSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRFPG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1098 LSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFN----FDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAV 1173
Cdd:pfam00520   81 LRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDkcedENENPINGNSNFDSYPEALLWLFRTLTTEGWGDI 160
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|
gi 24584554   1174 MYVGINAyggvssYGALACIYFIILFICGNYILLNVFLAI 1213
Cdd:pfam00520  161 MPDTLDA------GTVLGKIFFVIFIILGGFLLLNLLIGV 194
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1380-1611 3.75e-36

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


:

Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 138.57  E-value: 3.75e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1380 FDYFFTAVFTIELILKLISYGFVLHdgaFCRSAFNLLDLLVVC---VSLISLVSSSNAISVVKILRVLRVLRPLRAINRA 1456
Cdd:pfam00520    2 LDYVFTVIFTLEMLLKFIALGFKLS---YFRSPWNILDFLVVLpslVSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRF 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1457 KGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFKCTDgskmtqdecygtylvyddgdvhkprlREREWS 1536
Cdd:pfam00520   79 PGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCED--------------------------ENENPI 132
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 24584554   1537 NNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKenggpihNFRPIVaayyiiyiiiiaFFMVNIFVGFVIV 1611
Cdd:pfam00520  133 NGNSNFDSYPEALLWLFRTLTTEGWGDIMPDTLDAGT-------VLGKIF------------FVIFIILGGFLLL 188
 
Name Accession Description Interval E-value
Ca_chan_IQ pfam08763
Voltage gated calcium channel IQ domain; Voltage gated calcium channels control cellular ...
2062-2092 1.37e-15

Voltage gated calcium channel IQ domain; Voltage gated calcium channels control cellular calcium entry in response to changes in membrane potential. The isoleucine-glutamine (IQ) motif in the voltage gated calcium channel IQ domain interacts with hydrophobic pockets of Ca2+/calmodulin. The interaction regulates two self-regulatory calcium dependent feedback mechanism, calcium dependent inactivation (CDI), and calcium-dependent facilitation (CDF).


Pssm-ID: 149732  Cd Length: 32  Bit Score: 73.77  E-value: 1.37e-15
                           10        20        30
                   ....*....|....*....|....*....|.
gi 24584554   2062 DEVTVGKFYATYLIQDYFRRFKKRKEQEGKE 2092
Cdd:pfam08763    1 DEVTVGKFYATFLIQDYFRQFKKRKEQEQQG 31
Ca_chan_IQ smart01062
Voltage gated calcium channel IQ domain; Voltage gated calcium channels control cellular ...
2062-2092 6.52e-13

Voltage gated calcium channel IQ domain; Voltage gated calcium channels control cellular calcium entry in response to changes in membrane potential. The isoleucine-glutamine (IQ) motif in the voltage gated calcium channel IQ domain interacts with hydrophobic pockets of Ca2+/calmodulin. The interaction regulates two self-regulatory calcium dependent feedback mechanism, calcium dependent inactivation (CDI), and calcium-dependent facilitation (CDF).


Pssm-ID: 198130  Cd Length: 31  Bit Score: 66.09  E-value: 6.52e-13
                            10        20        30
                    ....*....|....*....|....*....|.
gi 24584554    2062 DEVTVGKFYATYLIQDYFRRFKKRKEQEGKE 2092
Cdd:smart01062    1 DELTVGKIYAAMLIQDYFRQFKSRKEQELLG 31
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
653-877 5.25e-52

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 184.41  E-value: 5.25e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554    653 VEYVFLVIFTAECVMKILAYGFVLHngaYLRNGWNLLDFTIVVIGAISTALSQL-MKDAFDVKALRAFRVLRPLRLVSGV 731
Cdd:pfam00520    2 LDYVFTVIFTLEMLLKFIALGFKLS---YFRSPWNILDFLVVLPSLVSLILRLLgEGSEGLLSVLRLLRLLRLLRLLRRF 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554    732 PSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKacrdeitgeyeenirpcgvgyqcppgykCYGGWDG 811
Cdd:pfam00520   79 PGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDK----------------------------CEDENEN 130
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 24584554    812 PNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAmGSDWQWMYFISMVILGAFFVMNLILGVL 877
Cdd:pfam00520  131 PINGNSNFDSYPEALLWLFRTLTTEGWGDIMPDTLDA-GTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1698-1925 1.97e-49

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 177.09  E-value: 1.97e-49
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1698 LNMIFTAVFALEFVFKLAAFRFK-NYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSqiaecdivegckstkksagsnli 1776
Cdd:pfam00520    2 LDYVFTVIFTLEMLLKFIALGFKlSYFRSPWNILDFLVVLPSLVSLILRLLGEGSEG----------------------- 58
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1777 SINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDGG----NAITANNNF 1852
Cdd:pfam00520   59 LLSVLRLLRLLRLLRLLRRFPGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEdeneNPINGNSNF 138
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 24584554   1853 QTFQQAVLVLFRSATGEAWQEIMMSCSAqpdvkcdmnsdtpgepCGSSIAYPYFISFYVLCSFLIINLFVAVI 1925
Cdd:pfam00520  139 DSYPEALLWLFRTLTTEGWGDIMPDTLD----------------AGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1019-1213 3.23e-48

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 173.24  E-value: 3.23e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1019 YTNVFFIGLFTCEMLLKMYSLGF-QGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRS 1097
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGFkLSYFRSPWNILDFLVVLPSLVSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRFPG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1098 LSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFN----FDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAV 1173
Cdd:pfam00520   81 LRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDkcedENENPINGNSNFDSYPEALLWLFRTLTTEGWGDI 160
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|
gi 24584554   1174 MYVGINAyggvssYGALACIYFIILFICGNYILLNVFLAI 1213
Cdd:pfam00520  161 MPDTLDA------GTVLGKIFFVIFIILGGFLLLNLLIGV 194
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1380-1611 3.75e-36

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 138.57  E-value: 3.75e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1380 FDYFFTAVFTIELILKLISYGFVLHdgaFCRSAFNLLDLLVVC---VSLISLVSSSNAISVVKILRVLRVLRPLRAINRA 1456
Cdd:pfam00520    2 LDYVFTVIFTLEMLLKFIALGFKLS---YFRSPWNILDFLVVLpslVSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRF 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1457 KGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFKCTDgskmtqdecygtylvyddgdvhkprlREREWS 1536
Cdd:pfam00520   79 PGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCED--------------------------ENENPI 132
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 24584554   1537 NNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKenggpihNFRPIVaayyiiyiiiiaFFMVNIFVGFVIV 1611
Cdd:pfam00520  133 NGNSNFDSYPEALLWLFRTLTTEGWGDIMPDTLDAGT-------VLGKIF------------FVIFIILGGFLLL 188
 
Name Accession Description Interval E-value
Ca_chan_IQ pfam08763
Voltage gated calcium channel IQ domain; Voltage gated calcium channels control cellular ...
2062-2092 1.37e-15

Voltage gated calcium channel IQ domain; Voltage gated calcium channels control cellular calcium entry in response to changes in membrane potential. The isoleucine-glutamine (IQ) motif in the voltage gated calcium channel IQ domain interacts with hydrophobic pockets of Ca2+/calmodulin. The interaction regulates two self-regulatory calcium dependent feedback mechanism, calcium dependent inactivation (CDI), and calcium-dependent facilitation (CDF).


Pssm-ID: 149732  Cd Length: 32  Bit Score: 73.77  E-value: 1.37e-15
                           10        20        30
                   ....*....|....*....|....*....|.
gi 24584554   2062 DEVTVGKFYATYLIQDYFRRFKKRKEQEGKE 2092
Cdd:pfam08763    1 DEVTVGKFYATFLIQDYFRQFKKRKEQEQQG 31
Ca_chan_IQ smart01062
Voltage gated calcium channel IQ domain; Voltage gated calcium channels control cellular ...
2062-2092 6.52e-13

Voltage gated calcium channel IQ domain; Voltage gated calcium channels control cellular calcium entry in response to changes in membrane potential. The isoleucine-glutamine (IQ) motif in the voltage gated calcium channel IQ domain interacts with hydrophobic pockets of Ca2+/calmodulin. The interaction regulates two self-regulatory calcium dependent feedback mechanism, calcium dependent inactivation (CDI), and calcium-dependent facilitation (CDF).


Pssm-ID: 198130  Cd Length: 31  Bit Score: 66.09  E-value: 6.52e-13
                            10        20        30
                    ....*....|....*....|....*....|.
gi 24584554    2062 DEVTVGKFYATYLIQDYFRRFKKRKEQEGKE 2092
Cdd:smart01062    1 DELTVGKIYAAMLIQDYFRQFKSRKEQELLG 31
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
653-877 5.25e-52

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 184.41  E-value: 5.25e-52
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554    653 VEYVFLVIFTAECVMKILAYGFVLHngaYLRNGWNLLDFTIVVIGAISTALSQL-MKDAFDVKALRAFRVLRPLRLVSGV 731
Cdd:pfam00520    2 LDYVFTVIFTLEMLLKFIALGFKLS---YFRSPWNILDFLVVLPSLVSLILRLLgEGSEGLLSVLRLLRLLRLLRLLRRF 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554    732 PSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKacrdeitgeyeenirpcgvgyqcppgykCYGGWDG 811
Cdd:pfam00520   79 PGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDK----------------------------CEDENEN 130
                          170       180       190       200       210       220
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 24584554    812 PNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAmGSDWQWMYFISMVILGAFFVMNLILGVL 877
Cdd:pfam00520  131 PINGNSNFDSYPEALLWLFRTLTTEGWGDIMPDTLDA-GTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1698-1925 1.97e-49

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 177.09  E-value: 1.97e-49
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1698 LNMIFTAVFALEFVFKLAAFRFK-NYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSqiaecdivegckstkksagsnli 1776
Cdd:pfam00520    2 LDYVFTVIFTLEMLLKFIALGFKlSYFRSPWNILDFLVVLPSLVSLILRLLGEGSEG----------------------- 58
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1777 SINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDGG----NAITANNNF 1852
Cdd:pfam00520   59 LLSVLRLLRLLRLLRLLRRFPGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCEdeneNPINGNSNF 138
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 24584554   1853 QTFQQAVLVLFRSATGEAWQEIMMSCSAqpdvkcdmnsdtpgepCGSSIAYPYFISFYVLCSFLIINLFVAVI 1925
Cdd:pfam00520  139 DSYPEALLWLFRTLTTEGWGDIMPDTLD----------------AGTVLGKIFFVIFIILGGFLLLNLLIGVI 195
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1019-1213 3.23e-48

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 173.24  E-value: 3.23e-48
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1019 YTNVFFIGLFTCEMLLKMYSLGF-QGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRS 1097
Cdd:pfam00520    1 ILDYVFTVIFTLEMLLKFIALGFkLSYFRSPWNILDFLVVLPSLVSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRFPG 80
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1098 LSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFN----FDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAV 1173
Cdd:pfam00520   81 LRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDkcedENENPINGNSNFDSYPEALLWLFRTLTTEGWGDI 160
                          170       180       190       200
                   ....*....|....*....|....*....|....*....|
gi 24584554   1174 MYVGINAyggvssYGALACIYFIILFICGNYILLNVFLAI 1213
Cdd:pfam00520  161 MPDTLDA------GTVLGKIFFVIFIILGGFLLLNLLIGV 194
Ion_trans pfam00520
Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This ...
1380-1611 3.75e-36

Ion transport protein; This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices


Pssm-ID: 249927 [Multi-domain]  Cd Length: 195  Bit Score: 138.57  E-value: 3.75e-36
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1380 FDYFFTAVFTIELILKLISYGFVLHdgaFCRSAFNLLDLLVVC---VSLISLVSSSNAISVVKILRVLRVLRPLRAINRA 1456
Cdd:pfam00520    2 LDYVFTVIFTLEMLLKFIALGFKLS---YFRSPWNILDFLVVLpslVSLILRLLGEGSEGLLSVLRLLRLLRLLRLLRRF 78
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1457 KGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFKCTDgskmtqdecygtylvyddgdvhkprlREREWS 1536
Cdd:pfam00520   79 PGLRTLLQSLGRSLKSLLNVLLLLLLLLFIFAIIGVQLFGGEFDKCED--------------------------ENENPI 132
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 24584554   1537 NNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKenggpihNFRPIVaayyiiyiiiiaFFMVNIFVGFVIV 1611
Cdd:pfam00520  133 NGNSNFDSYPEALLWLFRTLTTEGWGDIMPDTLDAGT-------VLGKIF------------FVIFIILGGFLLL 188
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
1701-1930 1.07e-06

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 254584 [Multi-domain]  Cd Length: 423  Bit Score: 51.96  E-value: 1.07e-06
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1701 IFTAVFALEFVFKLAAFRFKnYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAEcdIVEGCK---------STKKSA 1771
Cdd:pfam08016  217 VFVLYFVVAEITKIRREGPR-YLRSVWNLLDLAIVALSVVVIVLHIYRDFLATQLWK--QVEASPvdftdfdrvARLDQL 293
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1772 GSNLISINFF----RLFRVMRLVK---LLSKgegirtllwTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGkialdggn 1844
Cdd:pfam08016  294 YRIILAFLLFltwlKLFKVLRFNRtmsLFTK---------TLSRALKELLGFAVMFVILFLAYAQLGYLLFG-------- 356
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554   1845 aiTANNNFQTFQQAVLVLFRsatgeawqeiMMSCSAQpdvkcdmNSDTpgEPCGSSIAYPYFISFYVLCSFLIINLFVAV 1924
Cdd:pfam08016  357 --SQVDNFSNFVKSILTLFR----------TLCGDFG-------YTEI--FSGNRVLGPLLFLTFVFLVIFILLNLFLAI 415

                   ....*.
gi 24584554   1925 IMDNFD 1930
Cdd:pfam08016  416 INDSYV 421
PKD_channel pfam08016
Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 ...
643-877 1.15e-03

Polycystin cation channel; This family contains the cation channel region of PKD1 and PKD2 proteins.


Pssm-ID: 254584 [Multi-domain]  Cd Length: 423  Bit Score: 42.33  E-value: 1.15e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554    643 SNVTNQTLEkvEYVFLVIFtaeCVMKIL-----AYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALS--------QLMKD 709
Cdd:pfam08016  199 RFVTGLSLF--LLLCEIIF---LVFVLYfvvaeITKIRREGPRYLRSVWNLLDLAIVALSVVVIVLHiyrdflatQLWKQ 273
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554    710 --------------------AFDVKALRAF----RVLRPLRLVSGVPSLQVVLNSILKAmvpLFHIALLVLFVIIIYAII 765
Cdd:pfam08016  274 veaspvdftdfdrvarldqlYRIILAFLLFltwlKLFKVLRFNRTMSLFTKTLSRALKE---LLGFAVMFVILFLAYAQL 350
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24584554    766 GLELFSGKlhkacrdeitgeyeenirpcgvgyqcppgykcyggwdgpndgITNFDNFGLAMLTVFQ-CVTLEGWTDvLYS 844
Cdd:pfam08016  351 GYLLFGSQ------------------------------------------VDNFSNFVKSILTLFRtLCGDFGYTE-IFS 387
                          250       260       270
                   ....*....|....*....|....*....|...
gi 24584554    845 IQDAMGSdwqwMYFISMVILGAFFVMNLILGVL 877
Cdd:pfam08016  388 GNRVLGP----LLFLTFVFLVIFILLNLFLAII 416
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH