NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|24373679|ref|NP_717722|]
View 

protein phosphatase with response regulator reciever modulation [Shewanella oneidensis MR-1]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
195-390 8.45e-40

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 284611  Cd Length: 190  Bit Score: 143.55  E-value: 8.45e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   195 GNLFIMLADSTGHGLSAAMPIMLLTSTFRAMVSKGFSLVSLIYELNGKVFDEFPEDRFVACILLEADLFRNKLYVWNGGM 274
Cdd:pfam07228   2 GRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRLNRLLQRNLEEDMFATAVLAVYDPETGTLEYANAGH 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   275 PPVYLRLGHDEQHSDErasinkafKSTNMALGILPPNTFvaDIFSIDLPSEGYACLFSDGLIEQPALDGSPFGMVRLNAL 354
Cdd:pfam07228  82 PPPLLLRPDGGVVELL--------ESTGLPLGILPDADY--EVVELELEPGDTLLLYTDGLTEARDPDGELFGLERLLAL 151
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 24373679   355 FNEN----LDALPVFLDEHFSKyFYGDNIADDITICTLDF 390
Cdd:pfam07228 152 LAERhglpPEELLDALLEALLR-LGGGELEDDITLLVLRV 190
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
12-128 4.53e-14

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


:

Pssm-ID: 238088  Cd Length: 113  Bit Score: 69.14  E-value: 4.53e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  12 LIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVINDKKE 91
Cdd:cd00156   1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHGD 80
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 24373679  92 PQAFLDCFKMGVLDFIVKPINVEVfwykaeiLLTRIK 128
Cdd:cd00156  81 DEDAVEALKAGADDYLTKPFSPEE-------LLARIR 110
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
426-564 1.90e-08

Histidine kinase-like ATPase domain;


:

Pssm-ID: 290314  Cd Length: 125  Bit Score: 52.64  E-value: 1.90e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   426 DADYLGT----LNQFLSVFGFATNFCQRVFTVVAELFNNAIDHGVLEldsrlknDPEG-FELyhsirdsyaeRLSSDDwv 500
Cdd:pfam13581   4 DLEQLRAarrvLEAFLARAGLSEELLDEVELAVEEACTNAVRHAYRE-------GPGGpVRV----------RLASDG-- 64
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 24373679   501 kvcitwnhmNELVITVADSGKGFVGF-----DKSISSYPElSGRGISLVKTLCKHYELISPGNITRVVM 564
Cdd:pfam13581  65 ---------GALEVEVTDSGPPFDPLtlpdpDLEEEDRPE-GGRGLFLIRGLMDDVEYRRDGGGNVLTL 123
Snf7 super family cl21588
Snf7; This family of proteins are involved in protein sorting and transport from the endosome ...
100-169 1.50e-03

Snf7; This family of proteins are involved in protein sorting and transport from the endosome to the vacuole/lysosome in eukaryotic cells. Vacuoles/lysosomes play an important role in the degradation of both lipids and cellular proteins. In order to perform this degradative function, vacuoles/lysosomes contain numerous hydrolases which have been transported in the form of inactive precursors via the biosynthetic pathway and are proteolytically activated upon delivery to the vacuole/lysosome. The delivery of transmembrane proteins, such as activated cell surface receptors to the lumen of the vacuole/lysosome, either for degradation/downregulation, or in the case of hydrolases, for proper localization, requires the formation of multivesicular bodies (MVBs). These late endosomal structures are formed by invaginating and budding of the limiting membrane into the lumen of the compartment. During this process, a subset of the endosomal membrane proteins is sorted into the forming vesicles. Mature MVBs fuse with the vacuole/lysosome, thereby releasing cargo containing vesicles into its hydrolytic lumen for degradation. Endosomal proteins that are not sorted into the intralumenal MVB vesicles are either recycled back to the plasma membrane or Golgi complex, or remain in the limiting membrane of the MVB and are thereby transported to the limiting membrane of the vacuole/lysosome as a consequence of fusion. Therefore, the MVB sorting pathway plays a critical role in the decision between recycling and degradation of membrane proteins. A few archaeal sequences are also present within this family.


The actual alignment was detected with superfamily member PTZ00464:

Pssm-ID: 304451  Cd Length: 211  Bit Score: 39.03  E-value: 1.50e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 24373679  100 KMGVLDFIVKPINVEVFWYKAEILLTRIKLQRKVKQQSIEL--EKMLYEKAREEkLARHIFehlvNIDNNQF 169
Cdd:PTZ00464  26 RSEVVDARINKIDAELMKLKEQIQRTRGMTQSRHKQRAMQLlqQKRMYQNQQDM-MMQQQF----NMDQLQF 92
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
195-390 8.45e-40

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 143.55  E-value: 8.45e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   195 GNLFIMLADSTGHGLSAAMPIMLLTSTFRAMVSKGFSLVSLIYELNGKVFDEFPEDRFVACILLEADLFRNKLYVWNGGM 274
Cdd:pfam07228   2 GRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRLNRLLQRNLEEDMFATAVLAVYDPETGTLEYANAGH 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   275 PPVYLRLGHDEQHSDErasinkafKSTNMALGILPPNTFvaDIFSIDLPSEGYACLFSDGLIEQPALDGSPFGMVRLNAL 354
Cdd:pfam07228  82 PPPLLLRPDGGVVELL--------ESTGLPLGILPDADY--EVVELELEPGDTLLLYTDGLTEARDPDGELFGLERLLAL 151
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 24373679   355 FNEN----LDALPVFLDEHFSKyFYGDNIADDITICTLDF 390
Cdd:pfam07228 152 LAERhglpPEELLDALLEALLR-LGGGELEDDITLLVLRV 190
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
170-337 4.47e-17

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 79.31  E-value: 4.47e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679    170 DFIKSFCQASANFSGDILLNGVSPNGNLFIMLADSTGHGLSAAMPIMLLTSTFRAMVSKGFSLVSLIYELNGKVFDEFPE 249
Cdd:smart00331   4 GLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGED 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679    250 DRFVACILLEADLFRNKLYVWNGGMPPVYL-RLGHDEQHsderasinkAFKSTNMALGILPPNTFvaDIFSIDLPSEGYA 328
Cdd:smart00331  84 GMFATLFLALYDFAGGTLSYANAGHSPPYLlRADGGLVE---------DLDDLGAPLGLEPDVEV--DVRELTLEPGDLL 152

                   ....*....
gi 24373679    329 CLFSDGLIE 337
Cdd:smart00331 153 LLYTDGLTE 161
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
12-128 4.53e-14

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 69.14  E-value: 4.53e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  12 LIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVINDKKE 91
Cdd:cd00156   1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHGD 80
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 24373679  92 PQAFLDCFKMGVLDFIVKPINVEVfwykaeiLLTRIK 128
Cdd:cd00156  81 DEDAVEALKAGADDYLTKPFSPEE-------LLARIR 110
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
11-114 6.93e-12

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 278500  Cd Length: 111  Bit Score: 62.55  E-value: 6.93e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679    11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVINDKK 90
Cdd:pfam00072   1 VLIVDDDPLIRELLRQLLEKEGYVVAEADDGKEALELLKEERPDLILLDINMPGMDGLELLKRIRRRDPDTPVIILTAHG 80
                          90       100
                  ....*....|....*....|....
gi 24373679    91 EPQAFLDCFKMGVLDFIVKPINVE 114
Cdd:pfam00072  81 DEDDAVEALEAGADDFLSKPFDPD 104
CheY COG0784
CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];
11-128 1.13e-11

CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];


Pssm-ID: 223855  Cd Length: 130  Bit Score: 62.17  E-value: 1.13e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEV--SLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVIND 88
Cdd:COG0784   8 VLVVDDEPVNRRLLKRLLEDLGYEVVEAADGEEEALELlrELPQPDLILLDINMPGMDGIELLRRLRARGPNIPVILLTA 87
                        90       100       110       120
                ....*....|....*....|....*....|....*....|
gi 24373679  89 KKEPQAFLDCFKMGVLDFIVKPINVEvfwykaEILLTRIK 128
Cdd:COG0784  88 YADEADRERALAAGADDYLTKPIFLE------EELLAALR 121
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
426-564 1.90e-08

Histidine kinase-like ATPase domain;


Pssm-ID: 290314  Cd Length: 125  Bit Score: 52.64  E-value: 1.90e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   426 DADYLGT----LNQFLSVFGFATNFCQRVFTVVAELFNNAIDHGVLEldsrlknDPEG-FELyhsirdsyaeRLSSDDwv 500
Cdd:pfam13581   4 DLEQLRAarrvLEAFLARAGLSEELLDEVELAVEEACTNAVRHAYRE-------GPGGpVRV----------RLASDG-- 64
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 24373679   501 kvcitwnhmNELVITVADSGKGFVGF-----DKSISSYPElSGRGISLVKTLCKHYELISPGNITRVVM 564
Cdd:pfam13581  65 ---------GALEVEVTDSGPPFDPLtlpdpDLEEEDRPE-GGRGLFLIRGLMDDVEYRRDGGGNVLTL 123
PRK03660 PRK03660
anti-sigma F factor; Provisional
452-564 4.05e-05

anti-sigma F factor; Provisional


Pssm-ID: 179626  Cd Length: 146  Bit Score: 42.61  E-value: 4.05e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  452 TVVAELFNNAIDHGvleldsrLKNDPEGFelyhsirdsyaerlssddwVKVCITWNHmNELVITVADSGKGFVGFDKSI- 530
Cdd:PRK03660  42 TAVSEAVTNAIIHG-------YENNPDGV-------------------VYIEVEIEE-EELEITVRDEGKGIEDIEEAMq 94
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 24373679  531 ---SSYPEL--SGRGISLVKTLCKHYELIS-PGNITRVVM 564
Cdd:PRK03660  95 plyTTKPELerSGMGFTVMESFMDEVEVESePGKGTTVRM 134
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
11-58 4.76e-04

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 38.32  E-value: 4.76e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*...
gi 24373679     11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILV 58
Cdd:smart00448   3 ILVVDDDPLLRELLKALLEKEGYEVDEATDGEEALELLKEEKPDLILL 50
PTZ00464 PTZ00464
SNF-7-like protein; Provisional
100-169 1.50e-03

SNF-7-like protein; Provisional


Pssm-ID: 240425  Cd Length: 211  Bit Score: 39.03  E-value: 1.50e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 24373679  100 KMGVLDFIVKPINVEVFWYKAEILLTRIKLQRKVKQQSIEL--EKMLYEKAREEkLARHIFehlvNIDNNQF 169
Cdd:PTZ00464  26 RSEVVDARINKIDAELMKLKEQIQRTRGMTQSRHKQRAMQLlqQKRMYQNQQDM-MMQQQF----NMDQLQF 92
FtsB COG2919
Cell division protein FtsB [Cell cycle control, cell division, chromosome partitioning];
116-194 4.99e-03

Cell division protein FtsB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 225471  Cd Length: 117  Bit Score: 35.78  E-value: 4.99e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679 116 FWYKAEILLTRIKLQRKVKQQSIELEKMlyeKAREEKLARHIfehlvNIDNNQFDFIKSFCQASANFS--GDILLNGVSP 193
Cdd:COG2919  42 AWFGKNGAADVLQLQRQIAAQQAELEKL---SARNTALEAEI-----KDLKDGRDYIEERARSELGMSkpGEIFFRLVKP 113

                .
gi 24373679 194 N 194
Cdd:COG2919 114 S 114
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
128-392 2.15e-15

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 76.67  E-value: 2.15e-15
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679 128 KLQRKVKQQSIELEkmlyekareekLARHIFEHLVNIDNNQFDFIK--SFCQASANFSGDILLNGVSPNGNLFIMLADST 205
Cdd:COG2208 116 LLLLEQNNISAELE-----------VARQIQQNLLPKALPLFPGIDieAILVPASEVGGDYYDFIQLGEKRLRIGIGDVS 184
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679 206 GHGLSAAMPIMLLTSTFRAMVSKGFSLVS-LIYELNGKVFDEFPEDRFVACILLEADLFRNKLYVWNGGMPPVYLRlghd 284
Cdd:COG2208 185 GKGVPAALLMLMPKLALRLLLESGPLDPAdVLETLNRVLKQNLEEDMFVTLFLGVYDLDSGELTYSNAGHEPALIL---- 260
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679 285 eqHSDERASINKaFKSTNMALGILPpnTFVADIFSIDLPSEGYACLFSDGLIEQPALDGSPFGMVRLNALFNENLD-ALP 363
Cdd:COG2208 261 --SADGEIEVED-LTALGLPIGLLP--DYQYEVASLQLEPGDLLVLYTDGVTEARNSDGEFFGLERLLKILGRLLGqPAE 335
                       250       260       270
                ....*....|....*....|....*....|..
gi 24373679 364 VFLDEHFSKYF---YGDNIADDITICTLDFKR 392
Cdd:COG2208 336 EILEAILESLEelqGDQIQDDDITLLVLKVKK 367
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
11-137 1.60e-09

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 131209 [Multi-domain]  Cd Length: 226  Bit Score: 56.95  E-value: 1.60e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679    11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHL--DSLSKEIPVVVIND 88
Cdd:TIGR02154   5 ILVVEDEPAIRELIAYNLEKAGYDVVEAGDGDEALTLINERGPDLILLDWMLPGTSGIELCRRLrrRPETRAIPIIMLTA 84
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 24373679    89 KKEPQAFLDCFKMGVLDFIVKPinvevfwYKAEILLTRIK--LQRKVKQQS 137
Cdd:TIGR02154  85 RGEEEDRVRGLETGADDYITKP-------FSPRELLARIKavLRRIRPQLS 128
PRK10161 PRK10161
transcriptional regulator PhoB; Provisional
11-139 6.11e-08

transcriptional regulator PhoB; Provisional


Pssm-ID: 182277 [Multi-domain]  Cd Length: 229  Bit Score: 52.41  E-value: 6.11e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHL--DSLSKEIPVVVIND 88
Cdd:PRK10161   5 ILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLkrESMTRDIPVVMLTA 84
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 24373679   89 KKEPQAFLDCFKMGVLDFIVKPinvevfwYKAEILLTRIK-LQRKVKQQSIE 139
Cdd:PRK10161  85 RGEEEDRVRGLETGADDYITKP-------FSPKELVARIKaVMRRISPMAVE 129
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
195-390 8.45e-40

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 284611  Cd Length: 190  Bit Score: 143.55  E-value: 8.45e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   195 GNLFIMLADSTGHGLSAAMPIMLLTSTFRAMVSKGFSLVSLIYELNGKVFDEFPEDRFVACILLEADLFRNKLYVWNGGM 274
Cdd:pfam07228   2 GRVALVIGDVMGHGLPAALLMGMLRTALRALAAEGLDPAEVLKRLNRLLQRNLEEDMFATAVLAVYDPETGTLEYANAGH 81
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   275 PPVYLRLGHDEQHSDErasinkafKSTNMALGILPPNTFvaDIFSIDLPSEGYACLFSDGLIEQPALDGSPFGMVRLNAL 354
Cdd:pfam07228  82 PPPLLLRPDGGVVELL--------ESTGLPLGILPDADY--EVVELELEPGDTLLLYTDGLTEARDPDGELFGLERLLAL 151
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|
gi 24373679   355 FNEN----LDALPVFLDEHFSKyFYGDNIADDITICTLDF 390
Cdd:pfam07228 152 LAERhglpPEELLDALLEALLR-LGGGELEDDITLLVLRV 190
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
170-337 4.47e-17

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 79.31  E-value: 4.47e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679    170 DFIKSFCQASANFSGDILLNGVSPNGNLFIMLADSTGHGLSAAMPIMLLTSTFRAMVSKGFSLVSLIYELNGKVFDEFPE 249
Cdd:smart00331   4 GLIAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGED 83
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679    250 DRFVACILLEADLFRNKLYVWNGGMPPVYL-RLGHDEQHsderasinkAFKSTNMALGILPPNTFvaDIFSIDLPSEGYA 328
Cdd:smart00331  84 GMFATLFLALYDFAGGTLSYANAGHSPPYLlRADGGLVE---------DLDDLGAPLGLEPDVEV--DVRELTLEPGDLL 152

                   ....*....
gi 24373679    329 CLFSDGLIE 337
Cdd:smart00331 153 LLYTDGLTE 161
REC cd00156
Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and ...
12-128 4.53e-14

Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers


Pssm-ID: 238088  Cd Length: 113  Bit Score: 69.14  E-value: 4.53e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  12 LIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVINDKKE 91
Cdd:cd00156   1 LIVDDDPLIRELLRRLLEKEGYEVVEAEDGEEALALLAEEKPDLILLDIMMPGMDGLELLRRIRKRGPDIPIIFLTAHGD 80
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 24373679  92 PQAFLDCFKMGVLDFIVKPINVEVfwykaeiLLTRIK 128
Cdd:cd00156  81 DEDAVEALKAGADDYLTKPFSPEE-------LLARIR 110
Response_reg pfam00072
Response regulator receiver domain; This domain receives the signal from the sensor partner in ...
11-114 6.93e-12

Response regulator receiver domain; This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain.


Pssm-ID: 278500  Cd Length: 111  Bit Score: 62.55  E-value: 6.93e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679    11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVINDKK 90
Cdd:pfam00072   1 VLIVDDDPLIRELLRQLLEKEGYVVAEADDGKEALELLKEERPDLILLDINMPGMDGLELLKRIRRRDPDTPVIILTAHG 80
                          90       100
                  ....*....|....*....|....
gi 24373679    91 EPQAFLDCFKMGVLDFIVKPINVE 114
Cdd:pfam00072  81 DEDDAVEALEAGADDFLSKPFDPD 104
CheY COG0784
CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];
11-128 1.13e-11

CheY chemotaxis protein or a CheY-like REC (receiver) domain [Signal transduction mechanisms];


Pssm-ID: 223855  Cd Length: 130  Bit Score: 62.17  E-value: 1.13e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEV--SLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVIND 88
Cdd:COG0784   8 VLVVDDEPVNRRLLKRLLEDLGYEVVEAADGEEEALELlrELPQPDLILLDINMPGMDGIELLRRLRARGPNIPVILLTA 87
                        90       100       110       120
                ....*....|....*....|....*....|....*....|
gi 24373679  89 KKEPQAFLDCFKMGVLDFIVKPINVEvfwykaEILLTRIK 128
Cdd:COG0784  88 YADEADRERALAAGADDYLTKPIFLE------EELLAALR 121
HATPase_c_2 pfam13581
Histidine kinase-like ATPase domain;
426-564 1.90e-08

Histidine kinase-like ATPase domain;


Pssm-ID: 290314  Cd Length: 125  Bit Score: 52.64  E-value: 1.90e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   426 DADYLGT----LNQFLSVFGFATNFCQRVFTVVAELFNNAIDHGVLEldsrlknDPEG-FELyhsirdsyaeRLSSDDwv 500
Cdd:pfam13581   4 DLEQLRAarrvLEAFLARAGLSEELLDEVELAVEEACTNAVRHAYRE-------GPGGpVRV----------RLASDG-- 64
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 24373679   501 kvcitwnhmNELVITVADSGKGFVGF-----DKSISSYPElSGRGISLVKTLCKHYELISPGNITRVVM 564
Cdd:pfam13581  65 ---------GALEVEVTDSGPPFDPLtlpdpDLEEEDRPE-GGRGLFLIRGLMDDVEYRRDGGGNVLTL 123
PRK03660 PRK03660
anti-sigma F factor; Provisional
452-564 4.05e-05

anti-sigma F factor; Provisional


Pssm-ID: 179626  Cd Length: 146  Bit Score: 42.61  E-value: 4.05e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  452 TVVAELFNNAIDHGvleldsrLKNDPEGFelyhsirdsyaerlssddwVKVCITWNHmNELVITVADSGKGFVGFDKSI- 530
Cdd:PRK03660  42 TAVSEAVTNAIIHG-------YENNPDGV-------------------VYIEVEIEE-EELEITVRDEGKGIEDIEEAMq 94
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 24373679  531 ---SSYPEL--SGRGISLVKTLCKHYELIS-PGNITRVVM 564
Cdd:PRK03660  95 plyTTKPELerSGMGFTVMESFMDEVEVESePGKGTTVRM 134
REC smart00448
cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar ...
11-58 4.76e-04

cheY-homologous receiver domain; CheY regulates the clockwise rotation of E. coli flagellar motors. This domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologues.


Pssm-ID: 214668  Cd Length: 55  Bit Score: 38.32  E-value: 4.76e-04
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|....*...
gi 24373679     11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILV 58
Cdd:smart00448   3 ILVVDDDPLLRELLKALLEKEGYEVDEATDGEEALELLKEEKPDLILL 50
PTZ00464 PTZ00464
SNF-7-like protein; Provisional
100-169 1.50e-03

SNF-7-like protein; Provisional


Pssm-ID: 240425  Cd Length: 211  Bit Score: 39.03  E-value: 1.50e-03
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 24373679  100 KMGVLDFIVKPINVEVFWYKAEILLTRIKLQRKVKQQSIEL--EKMLYEKAREEkLARHIFehlvNIDNNQF 169
Cdd:PTZ00464  26 RSEVVDARINKIDAELMKLKEQIQRTRGMTQSRHKQRAMQLlqQKRMYQNQQDM-MMQQQF----NMDQLQF 92
FtsB COG2919
Cell division protein FtsB [Cell cycle control, cell division, chromosome partitioning];
116-194 4.99e-03

Cell division protein FtsB [Cell cycle control, cell division, chromosome partitioning];


Pssm-ID: 225471  Cd Length: 117  Bit Score: 35.78  E-value: 4.99e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679 116 FWYKAEILLTRIKLQRKVKQQSIELEKMlyeKAREEKLARHIfehlvNIDNNQFDFIKSFCQASANFS--GDILLNGVSP 193
Cdd:COG2919  42 AWFGKNGAADVLQLQRQIAAQQAELEKL---SARNTALEAEI-----KDLKDGRDYIEERARSELGMSkpGEIFFRLVKP 113

                .
gi 24373679 194 N 194
Cdd:COG2919 114 S 114
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, ...
128-392 2.15e-15

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms, Transcription];


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 76.67  E-value: 2.15e-15
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679 128 KLQRKVKQQSIELEkmlyekareekLARHIFEHLVNIDNNQFDFIK--SFCQASANFSGDILLNGVSPNGNLFIMLADST 205
Cdd:COG2208 116 LLLLEQNNISAELE-----------VARQIQQNLLPKALPLFPGIDieAILVPASEVGGDYYDFIQLGEKRLRIGIGDVS 184
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679 206 GHGLSAAMPIMLLTSTFRAMVSKGFSLVS-LIYELNGKVFDEFPEDRFVACILLEADLFRNKLYVWNGGMPPVYLRlghd 284
Cdd:COG2208 185 GKGVPAALLMLMPKLALRLLLESGPLDPAdVLETLNRVLKQNLEEDMFVTLFLGVYDLDSGELTYSNAGHEPALIL---- 260
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679 285 eqHSDERASINKaFKSTNMALGILPpnTFVADIFSIDLPSEGYACLFSDGLIEQPALDGSPFGMVRLNALFNENLD-ALP 363
Cdd:COG2208 261 --SADGEIEVED-LTALGLPIGLLP--DYQYEVASLQLEPGDLLVLYTDGVTEARNSDGEFFGLERLLKILGRLLGqPAE 335
                       250       260       270
                ....*....|....*....|....*....|..
gi 24373679 364 VFLDEHFSKYF---YGDNIADDITICTLDFKR 392
Cdd:COG2208 336 EILEAILESLEelqGDQIQDDDITLLVLKVKK 367
AtoC COG2204
DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, ...
11-162 3.95e-13

DNA-binding transcriptional response regulator, NtrC family, contains REC, AAA-type ATPase, and a Fis-type DNA-binding domains [Signal transduction mechanisms];


Pssm-ID: 225114 [Multi-domain]  Cd Length: 464  Bit Score: 70.42  E-value: 3.95e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVINDKK 90
Cdd:COG2204   7 ILVVDDDPDIRELLEQALELAGYEVVTAESAEEALEALSESPFDLVLLDIRMPGMDGLELLKEIKSRDPDLPVIVMTGHG 86
                        90       100       110       120       130       140       150
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 24373679  91 EPQAFLDCFKMGVLDFIVKPINVEvfwyKAEILLTRIKLQRKVKQqsielekmlyEKAREEKLARHIFEHLV 162
Cdd:COG2204  87 DIDTAVEALRLGAFDFLEKPFDLD----RLLAIVERALELRELQR----------ENRRSLKRAKSLGGELV 144
PleD COG3706
Two-component response regulator, PleD family, consists of two REC domains and a diguanylate ...
11-143 7.43e-13

Two-component response regulator, PleD family, consists of two REC domains and a diguanylate cyclase (GGDEF) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 226229 [Multi-domain]  Cd Length: 435  Bit Score: 69.27  E-value: 7.43e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSL--SKEIPVVVIND 88
Cdd:COG3706 135 ILVVDDDATQRERLRRILQVEGFRVVEATDGEEALLQLAELPPDLVLLDANMPDMDGLELCTRLRQLerTRDIPIILLSS 214
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 24373679  89 KKEPQAFLDCFKMGVLDFIVKPINVEVFWYKAEILLTRIKLQRKVK---QQSIELEKM 143
Cdd:COG3706 215 KDDDELVVRAFELGVNDYITKPIEEGELRARLRRQLRRKRYERQLReslERLQELALV 272
CitB COG4565
Response regulator of citrate/malate metabolism [Transcription, Signal transduction mechanisms] ...
11-152 1.07e-12

Response regulator of citrate/malate metabolism [Transcription, Signal transduction mechanisms];


Pssm-ID: 226931 [Multi-domain]  Cd Length: 224  Bit Score: 66.51  E-value: 1.07e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  11 ILIVDNDAIASQSISDFI-HGKGYNVI-ICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVIND 88
Cdd:COG4565   3 VLIIEDDPMVAEIHRRYVkQIPGFSVVgTAGTLEEAKMIIEEFKPDLILLDIYMPDGNGIELLPELRSQHYPVDVIVITA 82
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 24373679  89 KKEPQAFLDCFKMGVLDFIVKPINVEVFwykaEILLTRIKLQRKV--KQQSI---ELEKMLYEKAREEK 152
Cdd:COG4565  83 ASDMETIKEALRYGVVDYLIKPFTFERL----QQALTRYRQKRHAleSHQQLsqkELDQLFNIQSKEQP 147
RpfG COG3437
Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains ...
11-155 1.41e-11

Response regulator c-di-GMP phosphodiesterase, RpfG family, contains REC and HD-GYP domains [Signal transduction mechanisms];


Pssm-ID: 225971 [Multi-domain]  Cd Length: 360  Bit Score: 64.69  E-value: 1.41e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKE---IPVVVIN 87
Cdd:COG3437  17 VLLVDDEPDNLEALRQLLRMIGYRVIEAENGEEALKLLQEEPPDLVLLDVRMPEMDGAEVLNKLKAMSPStrrIPVILLT 96
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 24373679  88 DKKEPQAFLDCFKMGVLDFIVKPINVEVFWYKAEILLTRIKLQRKVKQQSIELEKMLYEkAREEKLAR 155
Cdd:COG3437  97 AYADSEDRQRALEAGADDYLSKPISPKELVARVSSHLQLKRNEDFLLDQNLYLELQELR-RRTEELAQ 163
OmpR COG0745
DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain ...
11-137 4.67e-11

DNA-binding response regulator, OmpR family, contains REC and winged-helix (wHTH) domain [Signal transduction mechanisms, Transcription];


Pssm-ID: 223816 [Multi-domain]  Cd Length: 229  Bit Score: 61.54  E-value: 4.67e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSlNKIDLILVNYFQPDGTALTLLAHLDSLSKE-IPVVVINDK 89
Cdd:COG0745   3 ILLVEDDPELAELLKEYLEEEGYEVDVAADGEEALEAAR-EQPDLVLLDLMLPDLDGLELCRRLRAKKGSgPPIIVLTAR 81
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*....
gi 24373679  90 KEPQAFLDCFKMGVLDFIVKPINVEVfwykaeiLLTRIK-LQRKVKQQS 137
Cdd:COG0745  82 DDEEDRVLGLEAGADDYLTKPFSPRE-------LLARLRaLLRRNAGAS 123
PhoB TIGR02154
phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response ...
11-137 1.60e-09

phosphate regulon transcriptional regulatory protein PhoB; PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion. PhoB acts as a positive regulator of gene expression for phosphate-related genes such as phoA, phoS, phoE and ugpAB as well as itself. It is often found proximal to genes for the high-affinity phosphate ABC transporter (pstSCAB; GenProp0190) and presumably regulates these as well. [Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 131209 [Multi-domain]  Cd Length: 226  Bit Score: 56.95  E-value: 1.60e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679    11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHL--DSLSKEIPVVVIND 88
Cdd:TIGR02154   5 ILVVEDEPAIRELIAYNLEKAGYDVVEAGDGDEALTLINERGPDLILLDWMLPGTSGIELCRRLrrRPETRAIPIIMLTA 84
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|.
gi 24373679    89 KKEPQAFLDCFKMGVLDFIVKPinvevfwYKAEILLTRIK--LQRKVKQQS 137
Cdd:TIGR02154  85 RGEEEDRVRGLETGADDYITKP-------FSPRELLARIKavLRRIRPQLS 128
SAPR COG3947
Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains [Signal ...
11-114 2.72e-09

Two-component response regulator, SAPR family, consists of REC, wHTH and BTAD domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 226456 [Multi-domain]  Cd Length: 361  Bit Score: 57.56  E-value: 2.72e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVINDKK 90
Cdd:COG3947   3 IIIVDDDAAIVKLLSVILSRAGHEVRSCSHPVEALDLLEVFKPDLIFLDIVMPYMNGIEFAEQVRDIESAVPIIFISSHA 82
                        90       100
                ....*....|....*....|....
gi 24373679  91 EPQafLDCFKMGVLDFIVKPINVE 114
Cdd:COG3947  83 EYA--DDSFGMNLDDYLPKPVTPE 104
CitB COG2197
DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains [Signal ...
11-116 2.90e-08

DNA-binding response regulator, NarL/FixJ family, contains REC and HTH domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 225107 [Multi-domain]  Cd Length: 211  Bit Score: 53.08  E-value: 2.90e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  11 ILIVDNDAIASQSISDFI-HGKGYNVI-ICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVIND 88
Cdd:COG2197   3 VLIVDDHPLVREGLRQLLeLEPDLEVVgEASNGEEALDLARELKPDVVLLDLSMPGMDGLEALKQLRARGPDIKVVVLTA 82
                        90       100
                ....*....|....*....|....*...
gi 24373679  89 KKEPQAFLDCFKMGVLDFIVKPINVEVF 116
Cdd:COG2197  83 HDDPAYVIRALRAGADGYLLKDASPEEL 110
PRK10161 PRK10161
transcriptional regulator PhoB; Provisional
11-139 6.11e-08

transcriptional regulator PhoB; Provisional


Pssm-ID: 182277 [Multi-domain]  Cd Length: 229  Bit Score: 52.41  E-value: 6.11e-08
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHL--DSLSKEIPVVVIND 88
Cdd:PRK10161   5 ILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFIKHLkrESMTRDIPVVMLTA 84
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
gi 24373679   89 KKEPQAFLDCFKMGVLDFIVKPinvevfwYKAEILLTRIK-LQRKVKQQSIE 139
Cdd:PRK10161  85 RGEEEDRVRGLETGADDYITKP-------FSPKELVARIKaVMRRISPMAVE 129
PRK10766 PRK10766
DNA-binding transcriptional regulator TorR; Provisional
9-139 1.28e-07

DNA-binding transcriptional regulator TorR; Provisional


Pssm-ID: 182711 [Multi-domain]  Cd Length: 221  Bit Score: 51.19  E-value: 1.28e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679    9 HFILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSkEIPVVVIND 88
Cdd:PRK10766   3 YHILVVEDEPVTRARLQGYFEQEGYTVSEAASGAGMREIMQNQHVDLILLDINLPGEDGLMLTRELRSRS-TVGIILVTG 81
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|.
gi 24373679   89 KKEPQAFLDCFKMGVLDFIVKPINVEVFWYKAEILLTRIKLQRKVKQQSIE 139
Cdd:PRK10766  82 RTDSIDRIVGLEMGADDYVTKPLELRELLVRVKNLLWRISLARQAQPHAQE 132
PRK10365 PRK10365
transcriptional regulatory protein ZraR; Provisional
11-114 1.35e-07

transcriptional regulatory protein ZraR; Provisional


Pssm-ID: 182412 [Multi-domain]  Cd Length: 441  Bit Score: 52.73  E-value: 1.35e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVINDKK 90
Cdd:PRK10365   8 ILVVDDDISHCTILQALLRGWGYNVALANSGRQALEQVREQVFDLVLCDVRMAEMDGIATLKEIKALNPAIPVLIMTAYS 87
                         90       100
                 ....*....|....*....|....
gi 24373679   91 EPQAFLDCFKMGVLDFIVKPINVE 114
Cdd:PRK10365  88 SVETAVEALKTGALDYLIKPLDFD 111
dpiA PRK10046
two-component response regulator DpiA; Provisional
11-151 2.66e-06

two-component response regulator DpiA; Provisional


Pssm-ID: 182208 [Multi-domain]  Cd Length: 225  Bit Score: 47.32  E-value: 2.66e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   11 ILIVDNDAIASQSISDFI-HGKGYNVI-ICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVIND 88
Cdd:PRK10046   7 LLIVEDETPLAEMHAEYIrHIPGFSQIlLAGNLAQARMMIERFKPGLILLDNYLPDGRGINLLHELVQAHYPGDVVFTTA 86
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 24373679   89 KKEPQAFLDCFKMGVLDFIVKPINVEvfwyKAEILLTRIKlQRKVKQQSI------ELEKMLYEKAREE 151
Cdd:PRK10046  87 ASDMETVSEAVRCGVFDYLIKPIAYE----RLGQTLTRFR-QRKHMLESIdsasqkQIDEMFNAYARGE 150
pleD PRK09581
response regulator PleD; Reviewed
11-140 2.85e-06

response regulator PleD; Reviewed


Pssm-ID: 236577 [Multi-domain]  Cd Length: 457  Bit Score: 48.36  E-value: 2.85e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   11 ILIVDNDAIASQSISDfIHGKGYNVIICDNLEDAFFEVSLNKIDLILVN----YFQPdgtaLTLLAHLDSL--SKEIPVV 84
Cdd:PRK09581 158 ILLVDDDVSQAERIAN-ILKEEFRVVVVSDPSEALFNAAETNYDLVIVSanfeNYDP----LRLCSQLRSKerTRYVPIL 232
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 24373679   85 VINDKKEPQAFLDCFKMGVLDFIVKPINvevfwyKAEiLLTRIKLQRKVK----------QQSIEL 140
Cdd:PRK09581 233 LLVDEDDDPRLVKALELGVNDYLMRPID------KNE-LLARVRTQIRRKryqdalrnnlEQSIEM 291
PLN03029 PLN03029
type-a response regulator protein; Provisional
1-151 3.56e-06

type-a response regulator protein; Provisional


Pssm-ID: 215544 [Multi-domain]  Cd Length: 222  Bit Score: 46.95  E-value: 3.56e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679    1 MSANLEINHFILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAF-F--------------EVSLN-----KIDLILVNY 60
Cdd:PLN03029   1 MGITTESQFHVLAVDDSLIDRKLIEKLLKTSSYQVTTVDSGSKALkFlglheddrsnpdtpSVSPNshqevEVNLIITDY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   61 FQPDGTALTLLAHLDSLS--KEIPVVVINDKKEPQAFLDCFKMGVLDFIVKPINV-EVFWYKAEILLTRIKLQRK---VK 134
Cdd:PLN03029  81 CMPGMTGYDLLKKIKESSslRNIPVVIMSSENVPSRITRCLEEGAEEFFLKPVQLsDLNRLKPHMMKTKSKNQKQenqEK 160
                        170
                 ....*....|....*..
gi 24373679  135 QQSIELEKMLYEKAREE 151
Cdd:PLN03029 161 QEKLEESEIQSEKQEQP 177
PRK11361 PRK11361
acetoacetate metabolism regulatory protein AtoC; Provisional
11-153 2.03e-05

acetoacetate metabolism regulatory protein AtoC; Provisional


Pssm-ID: 183099 [Multi-domain]  Cd Length: 457  Bit Score: 45.61  E-value: 2.03e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVINDKK 90
Cdd:PRK11361   7 ILIVDDEDNVRRMLSTAFALQGFETHCANNGRTALHLFADIHPDVVLMDIRMPEMDGIKALKEMRSHETRTPVILMTAYA 86
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 24373679   91 EPQAFLDCFKMGVLDFIVKPINVEvfwykaEI-LLTRIKLQ-RKVKQQSIELEKMLYEKAREEKL 153
Cdd:PRK11361  87 EVETAVEALRCGAFDYVIKPFDLD------ELnLIVQRALQlQSMKKEIRHLHQALSTSWQWGHI 145
PRK10529 PRK10529
DNA-binding transcriptional activator KdpE; Provisional
11-113 2.05e-05

DNA-binding transcriptional activator KdpE; Provisional


Pssm-ID: 182522 [Multi-domain]  Cd Length: 225  Bit Score: 44.80  E-value: 2.05e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679   11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKeIPVVVINDKK 90
Cdd:PRK10529   4 VLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATRKPDLIILDLGLPDGDGIEFIRDLRQWSA-IPVIVLSARS 82
                         90       100
                 ....*....|....*....|...
gi 24373679   91 EPQAFLDCFKMGVLDFIVKPINV 113
Cdd:PRK10529  83 EESDKIAALDAGADDYLSKPFGI 105
YesN COG4753
Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding ...
11-155 2.77e-05

Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding domains [Signal transduction mechanisms, Transcription];


Pssm-ID: 227095 [Multi-domain]  Cd Length: 475  Bit Score: 45.43  E-value: 2.77e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679  11 ILIVDNDAIASQSISDFIHGK--GYNVI-ICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVIN 87
Cdd:COG4753   4 VLIVDDEPLIREGLKSLIDWEalGIEVVgTAANGKEALELIQETQPDIVITDINMPGMDGLDLIKAIKEQSPDTEFIILS 83
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 24373679  88 DKKEPQAFLDCFKMGVLDFIVKPINVEVFWYKAEILLTRIKLQRKVKQqsiELEKMLYEKAREEKLAR 155
Cdd:COG4753  84 GYDEFEYAKKAMKLGVKDYLLKPVDKAELEEALKKIIGKLEEQQKVKQ---DIEKLLTLLIGHEPLEE 148
ntrC TIGR01818
nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response ...
11-114 1.57e-03

nitrogen regulation protein NR(I); This model represents NtrC, a DNA-binding response regulator that is phosphorylated by NtrB and interacts with sigma-54. NtrC usually controls the expression of glutamine synthase, GlnA, and may be called GlnL, GlnG, etc. [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, DNA interactions, Signal transduction, Two-component systems]


Pssm-ID: 273818 [Multi-domain]  Cd Length: 463  Bit Score: 39.72  E-value: 1.57e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 24373679    11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVVVINDKK 90
Cdd:TIGR01818   1 VWVVDDDRSIRWVLEKALSRAGYEVRTFGNAASVLRALARGQPDLLITDVRMPGEDGLDLLPQIKKRHPQLPVIVMTAHS 80
                          90       100
                  ....*....|....*....|....
gi 24373679    91 EPQAFLDCFKMGVLDFIVKPINVE 114
Cdd:TIGR01818  81 DLDTAVAAYQRGAFEYLPKPFDLD 104
TMAO_torS TIGR02956
TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the ...
11-84 1.96e-03

TMAO reductase sytem sensor TorS; This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC). TorS works together with the inducer-binding protein TorT and the response regulator TorR. TorS contains histidine kinase ATPase (pfam02518), HAMP (pfam00672), phosphoacceptor (pfam00512), and phosphotransfer (pfam01627) domains and a response regulator receiver domain (pfam00072). [Signal transduction, Two-component systems]


Pssm-ID: 274362 [Multi-domain]  Cd Length: 968  Bit Score: 39.76  E-value: 1.96e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 24373679    11 ILIVDNDAIASQSISDFIHGKGYNVIICDNLEDAFFEVSLNKIDLILVNYFQPDGTALTLLAHLDSLSKEIPVV 84
Cdd:TIGR02956 705 VLLVEDNEVNQMVAQGFLTRLGHKVTLAESGQSALECFHQHAFDLALLDINLPDGDGVTLLQQLRAIYGAKNEV 778
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH