NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|238922944|ref|YP_002936457|]
View 

phosphoprotein phosphatase [Eubacterium rectale ATCC 33656]

Graphical summary

show options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
433-616 3.26e-27

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


:

Pssm-ID: 254114  Cd Length: 192  Bit Score: 108.92  E-value: 3.26e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  433 DDGMYHVCVSDGMGSGKQAQAESTLVVDLLEKLLEAGFSRESALKLMNSAMVISAGEESYSTVDFATIDMYTGELELAKT 512
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGERFATAVLAVYDPETGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  513 GAAPSFIKS--GKQVSVIENESLPAGVD---VWQESKHsknTLQSGDFLVMVTDGVLEylhVKDRQG------KLMDIIA 581
Cdd:pfam07228  81 GHPPPLLLRpdGGVVELLESPGLPLGVLpdaPYETAEF---PLEPGDTLLLYTDGLTE---ARDPDGelfgleRLLALLA 154
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 238922944  582 GVKSDNAGVMAQEILDRVLLDTGGYAMDDMTVVAI 616
Cdd:pfam07228 155 ERHGLSPEELLDALLEDLLRLGGGELEDDITLLVL 189
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
168-619 1.66e-69

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs [Cellular processes, Sporulation and germination].


:

Pssm-ID: 234038 [Multi-domain]  Cd Length: 764  Bit Score: 241.13  E-value: 1.66e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  168 DREEAFATAVSGLSGIISTANVmavkcTADKIPDESEKIQL--EVTGRLCACCEGCSVCWT-SGTSISDSIKMLADAVRK 244
Cdd:TIGR02865 314 EKLEEFSEVFRELSNTFVEALA-----SNEKLTMKRKSSYLleNLAERVCQSCNMKHRCWKrEFDYTYSAMEELIENLEE 388
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  245 RMKTEEIVQNRYVDGCPHYTRMVEAATEAFARIELNEAWYRRLTENRRVIATQLDAMAELMDswcRAEKCIDKKRR---L 321
Cdd:TIGR02865 389 KKDPNSKLPDEFERKCIKRKELINTTEDILNNYIINEMWRKRLEEGRRLVAEQLKGVAESVE---DIAKEINLEIVfhqL 465
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  322 RLTRVYVYTKEAGIQVENAHIY--ENARQQVCIKADVCTKidGGIEISKYVQAVSRAMGVKLRQAHGTVSIISDERTSIV 399
Cdd:TIGR02865 466 LEEKIIRALNKNGIPYEDVLAYntEGGNIDVELTIAACGG--RGECEKKIAPIISEVTGELMCVKDERCSIDPKGRCHLT 543
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  400 LYEENQFYALSGVATKKKTGSQANGDSCSMFQLDDGMYHVCVSDGMGSGKQAQAESTLVVDLLEKLLEAGFSRESALKLM 479
Cdd:TIGR02865 544 FEETPKYHVSTGVARAAKDGELVSGDSYSFGKLSAGKYAVAISDGMGSGPEAAQESSACVRLLEKFLESGFDREVAIKTV 623
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  480 NSAMVISAGEESYSTVDFATIDMYTGELELAKTGAAPSFIKSGKQVSVIENESLPAGV--DVWQESKHSKntLQSGDFLV 557
Cdd:TIGR02865 624 NSILSLRSTDEKFSTLDLSVIDLYTGQAEFVKVGAVPSFIKRGAKVEVIRSSNLPIGIldEVDVELVRKK--LKNGDLIV 701
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 238922944  558 MVTDGVLEY-LHVKDRQGKLMDIIAGVKSDNAGVMAQEILDRVLLDTGGYAMDDMTVVAIGIW 619
Cdd:TIGR02865 702 MVSDGVLEGeKEVEGKVLWLVRKLKETNTNDPEEIAEYLLEKAKELRSGKIKDDMTVIVAKVY 764
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
433-616 3.26e-27

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 108.92  E-value: 3.26e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  433 DDGMYHVCVSDGMGSGKQAQAESTLVVDLLEKLLEAGFSRESALKLMNSAMVISAGEESYSTVDFATIDMYTGELELAKT 512
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGERFATAVLAVYDPETGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  513 GAAPSFIKS--GKQVSVIENESLPAGVD---VWQESKHsknTLQSGDFLVMVTDGVLEylhVKDRQG------KLMDIIA 581
Cdd:pfam07228  81 GHPPPLLLRpdGGVVELLESPGLPLGVLpdaPYETAEF---PLEPGDTLLLYTDGLTE---ARDPDGelfgleRLLALLA 154
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 238922944  582 GVKSDNAGVMAQEILDRVLLDTGGYAMDDMTVVAI 616
Cdd:pfam07228 155 ERHGLSPEELLDALLEDLLRLGGGELEDDITLLVL 189
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
412-600 4.06e-22

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 94.34  E-value: 4.06e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944   412 VATKKKTGSQANGDSCSMFQLDDGMYHVCVSDGMGSGKQAQAESTLVVDLLEKLLEAGFSRESALKLMNSAMVISAGEES 491
Cdd:smart00331   6 IAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGEDGM 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944   492 YSTVDFATIDMYTGELELAKTGAAPSFIK--SGKQVSVIENESLPAGVDVWQESKHSKNTLQSGDFLVMVTDGVLEylhv 569
Cdd:smart00331  86 FATLFLALYDFAGGTLSYANAGHSPPYLLraDGGLVEDLDDLGAPLGLEPDVEVDVRELTLEPGDLLLLYTDGLTE---- 161
                          170       180       190
                   ....*....|....*....|....*....|.
gi 238922944   570 KDRQGKLMDIIAGVKSDNAGVMAQEILDRVL 600
Cdd:smart00331 162 ARNPERLEELLEELLGSPPAEIAQRILEELL 192
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
168-619 1.66e-69

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs [Cellular processes, Sporulation and germination].


Pssm-ID: 234038 [Multi-domain]  Cd Length: 764  Bit Score: 241.13  E-value: 1.66e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  168 DREEAFATAVSGLSGIISTANVmavkcTADKIPDESEKIQL--EVTGRLCACCEGCSVCWT-SGTSISDSIKMLADAVRK 244
Cdd:TIGR02865 314 EKLEEFSEVFRELSNTFVEALA-----SNEKLTMKRKSSYLleNLAERVCQSCNMKHRCWKrEFDYTYSAMEELIENLEE 388
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  245 RMKTEEIVQNRYVDGCPHYTRMVEAATEAFARIELNEAWYRRLTENRRVIATQLDAMAELMDswcRAEKCIDKKRR---L 321
Cdd:TIGR02865 389 KKDPNSKLPDEFERKCIKRKELINTTEDILNNYIINEMWRKRLEEGRRLVAEQLKGVAESVE---DIAKEINLEIVfhqL 465
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  322 RLTRVYVYTKEAGIQVENAHIY--ENARQQVCIKADVCTKidGGIEISKYVQAVSRAMGVKLRQAHGTVSIISDERTSIV 399
Cdd:TIGR02865 466 LEEKIIRALNKNGIPYEDVLAYntEGGNIDVELTIAACGG--RGECEKKIAPIISEVTGELMCVKDERCSIDPKGRCHLT 543
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  400 LYEENQFYALSGVATKKKTGSQANGDSCSMFQLDDGMYHVCVSDGMGSGKQAQAESTLVVDLLEKLLEAGFSRESALKLM 479
Cdd:TIGR02865 544 FEETPKYHVSTGVARAAKDGELVSGDSYSFGKLSAGKYAVAISDGMGSGPEAAQESSACVRLLEKFLESGFDREVAIKTV 623
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  480 NSAMVISAGEESYSTVDFATIDMYTGELELAKTGAAPSFIKSGKQVSVIENESLPAGV--DVWQESKHSKntLQSGDFLV 557
Cdd:TIGR02865 624 NSILSLRSTDEKFSTLDLSVIDLYTGQAEFVKVGAVPSFIKRGAKVEVIRSSNLPIGIldEVDVELVRKK--LKNGDLIV 701
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 238922944  558 MVTDGVLEY-LHVKDRQGKLMDIIAGVKSDNAGVMAQEILDRVLLDTGGYAMDDMTVVAIGIW 619
Cdd:TIGR02865 702 MVSDGVLEGeKEVEGKVLWLVRKLKETNTNDPEEIAEYLLEKAKELRSGKIKDDMTVIVAKVY 764
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
420-616 3.69e-21

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 94.39  E-value: 3.69e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944 420 SQANGDSCSMFQLDDGMYHVCVSDGMGSGKQAQAESTLVVDLLEKLLEAGFSRES-ALKLMNSAMVISAGEESYSTVDFA 498
Cdd:COG2208  159 SEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESGPLDPAdVLETLNRVLKQNLEEDMFVTLFLG 238
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944 499 TIDMYTGELELAKTGAAPSFIKSGK---QVSVIENESLPAG-VDVWQESKHSKNtLQSGDFLVMVTDGVLEylhVKDRQG 574
Cdd:COG2208  239 VYDLDSGELTYSNAGHEPALILSADgeiEVEDLTALGLPIGlLPDYQYEVASLQ-LEPGDLLVLYTDGVTE---ARNSDG 314
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
gi 238922944 575 ------KLMDIIAGVKSDNAGVMAQEILDRVLLDTGGYAM-DDMTVVAI 616
Cdd:COG2208  315 effgleRLLKILGRLLGQPAEEILEAILESLEELQGDQIQdDDITLLVL 363
 
Name Accession Description Interval E-value
SpoIIE pfam07228
Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II ...
433-616 3.26e-27

Stage II sporulation protein E (SpoIIE); This family contains a number of bacterial stage II sporulation E proteins (EC:3.1.3.16). These are required for formation of a normal polar septum during sporulation. The N-terminal region is hydrophobic and is expected to contain up to 12 membrane-spanning segments.


Pssm-ID: 254114  Cd Length: 192  Bit Score: 108.92  E-value: 3.26e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  433 DDGMYHVCVSDGMGSGKQAQAESTLVVDLLEKLLEAGFSRESALKLMNSAMVISAGEESYSTVDFATIDMYTGELELAKT 512
Cdd:pfam07228   1 PDGRVALVIGDVMGHGLPAALLMGMLRTALRALALEGLDPAEVLERLNRALQRNLEGERFATAVLAVYDPETGTLEYANA 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  513 GAAPSFIKS--GKQVSVIENESLPAGVD---VWQESKHsknTLQSGDFLVMVTDGVLEylhVKDRQG------KLMDIIA 581
Cdd:pfam07228  81 GHPPPLLLRpdGGVVELLESPGLPLGVLpdaPYETAEF---PLEPGDTLLLYTDGLTE---ARDPDGelfgleRLLALLA 154
                         170       180       190
                  ....*....|....*....|....*....|....*
gi 238922944  582 GVKSDNAGVMAQEILDRVLLDTGGYAMDDMTVVAI 616
Cdd:pfam07228 155 ERHGLSPEELLDALLEDLLRLGGGELEDDITLLVL 189
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
412-600 4.06e-22

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 94.34  E-value: 4.06e-22
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944   412 VATKKKTGSQANGDSCSMFQLDDGMYHVCVSDGMGSGKQAQAESTLVVDLLEKLLEAGFSRESALKLMNSAMVISAGEES 491
Cdd:smart00331   6 IAQYYEDATQVGGDFYDVVKLPEGRLLIAIADVMGKGLAAALAMSMARSALRTLLSEGISLSQILERLNRAIYENGEDGM 85
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944   492 YSTVDFATIDMYTGELELAKTGAAPSFIK--SGKQVSVIENESLPAGVDVWQESKHSKNTLQSGDFLVMVTDGVLEylhv 569
Cdd:smart00331  86 FATLFLALYDFAGGTLSYANAGHSPPYLLraDGGLVEDLDDLGAPLGLEPDVEVDVRELTLEPGDLLLLYTDGLTE---- 161
                          170       180       190
                   ....*....|....*....|....*....|.
gi 238922944   570 KDRQGKLMDIIAGVKSDNAGVMAQEILDRVL 600
Cdd:smart00331 162 ARNPERLEELLEELLGSPPAEIAQRILEELL 192
spore_II_E TIGR02865
stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane ...
168-619 1.66e-69

stage II sporulation protein E; Stage II sporulation protein E (SpoIIE) is a multiple membrane spanning protein with two separable functions. It plays a role in the switch to polar cell division during sporulation. By means of it protein phosphatase activity, located in the C-terminal region, it activates sigma-F. All proteins that score above the trusted cutoff to this model are found in endospore-forming Gram-positive bacteria. Surprisingly, a sequence from the Cyanobacterium-like (and presumably non-spore-forming) photosynthesizer Heliobacillus mobilis is homologous, and scores between the trusted and noise cutoffs [Cellular processes, Sporulation and germination].


Pssm-ID: 234038 [Multi-domain]  Cd Length: 764  Bit Score: 241.13  E-value: 1.66e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  168 DREEAFATAVSGLSGIISTANVmavkcTADKIPDESEKIQL--EVTGRLCACCEGCSVCWT-SGTSISDSIKMLADAVRK 244
Cdd:TIGR02865 314 EKLEEFSEVFRELSNTFVEALA-----SNEKLTMKRKSSYLleNLAERVCQSCNMKHRCWKrEFDYTYSAMEELIENLEE 388
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  245 RMKTEEIVQNRYVDGCPHYTRMVEAATEAFARIELNEAWYRRLTENRRVIATQLDAMAELMDswcRAEKCIDKKRR---L 321
Cdd:TIGR02865 389 KKDPNSKLPDEFERKCIKRKELINTTEDILNNYIINEMWRKRLEEGRRLVAEQLKGVAESVE---DIAKEINLEIVfhqL 465
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  322 RLTRVYVYTKEAGIQVENAHIY--ENARQQVCIKADVCTKidGGIEISKYVQAVSRAMGVKLRQAHGTVSIISDERTSIV 399
Cdd:TIGR02865 466 LEEKIIRALNKNGIPYEDVLAYntEGGNIDVELTIAACGG--RGECEKKIAPIISEVTGELMCVKDERCSIDPKGRCHLT 543
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  400 LYEENQFYALSGVATKKKTGSQANGDSCSMFQLDDGMYHVCVSDGMGSGKQAQAESTLVVDLLEKLLEAGFSRESALKLM 479
Cdd:TIGR02865 544 FEETPKYHVSTGVARAAKDGELVSGDSYSFGKLSAGKYAVAISDGMGSGPEAAQESSACVRLLEKFLESGFDREVAIKTV 623
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944  480 NSAMVISAGEESYSTVDFATIDMYTGELELAKTGAAPSFIKSGKQVSVIENESLPAGV--DVWQESKHSKntLQSGDFLV 557
Cdd:TIGR02865 624 NSILSLRSTDEKFSTLDLSVIDLYTGQAEFVKVGAVPSFIKRGAKVEVIRSSNLPIGIldEVDVELVRKK--LKNGDLIV 701
                         410       420       430       440       450       460
                  ....*....|....*....|....*....|....*....|....*....|....*....|...
gi 238922944  558 MVTDGVLEY-LHVKDRQGKLMDIIAGVKSDNAGVMAQEILDRVLLDTGGYAMDDMTVVAIGIW 619
Cdd:TIGR02865 702 MVSDGVLEGeKEVEGKVLWLVRKLKETNTNDPEEIAEYLLEKAKELRSGKIKDDMTVIVAKVY 764
RsbU COG2208
Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / ...
420-616 3.69e-21

Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]


Pssm-ID: 225118 [Multi-domain]  Cd Length: 367  Bit Score: 94.39  E-value: 3.69e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944 420 SQANGDSCSMFQLDDGMYHVCVSDGMGSGKQAQAESTLVVDLLEKLLEAGFSRES-ALKLMNSAMVISAGEESYSTVDFA 498
Cdd:COG2208  159 SEVGGDYYDFIQLGEKRLRIGIGDVSGKGVPAALLMLMPKLALRLLLESGPLDPAdVLETLNRVLKQNLEEDMFVTLFLG 238
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 238922944 499 TIDMYTGELELAKTGAAPSFIKSGK---QVSVIENESLPAG-VDVWQESKHSKNtLQSGDFLVMVTDGVLEylhVKDRQG 574
Cdd:COG2208  239 VYDLDSGELTYSNAGHEPALILSADgeiEVEDLTALGLPIGlLPDYQYEVASLQ-LEPGDLLVLYTDGVTE---ARNSDG 314
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*....
gi 238922944 575 ------KLMDIIAGVKSDNAGVMAQEILDRVLLDTGGYAM-DDMTVVAI 616
Cdd:COG2208  315 effgleRLLKILGRLLGQPAEEILEAILESLEELQGDQIQdDDITLLVL 363
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.11
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH