NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|23465170|ref|NP_695773.1|]
View 

phosphoprotein phosphatase [Bifidobacterium longum NCC2705]

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
13-247 1.19e-51

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


:

Pssm-ID: 238083  Cd Length: 254  Bit Score: 178.67  E-value: 1.19e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  13 YSTTVSDVGTVRANNQDSSFA-------GEHLIAMCDGMGGHAGGDTASSIAIRSLAHIEQDDTGGNVETISRMMETSVM 85
Cdd:cd00143   1 FSAGVSDKGGDRKTNEDAVVIkpnlnneDGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKAFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  86 AAHDAIVGKAKRERKLAGMGTTVTAVALVAGYWVIAHIGDSRAYLLRDGRLSRITCDHSYVQhLINTGRITPSEA----K 161
Cdd:cd00143  81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVN-EEERERIEKAGGrvsnG 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170 162 NHPQRNVVMRVLGDFD----IDPRPDISVRRAHPADRWL-LCSDGLCGVLEDSTIEETMTTLSDQG---ECAQRLVQMAL 233
Cdd:cd00143 160 RVPGVLAVTRALGDFDlkpgVSAEPDVTVVKLTEDDDFLiLASDGLWDVLSNQEAVDIVRSELAKEdlqEAAQELVDLAL 239
                       250
                ....*....|....
gi 23465170 234 RAGSTDNVTAVIAD 247
Cdd:cd00143 240 RRGSHDNITVVVVR 253
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
13-247 1.19e-51

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 178.67  E-value: 1.19e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  13 YSTTVSDVGTVRANNQDSSFA-------GEHLIAMCDGMGGHAGGDTASSIAIRSLAHIEQDDTGGNVETISRMMETSVM 85
Cdd:cd00143   1 FSAGVSDKGGDRKTNEDAVVIkpnlnneDGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKAFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  86 AAHDAIVGKAKRERKLAGMGTTVTAVALVAGYWVIAHIGDSRAYLLRDGRLSRITCDHSYVQhLINTGRITPSEA----K 161
Cdd:cd00143  81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVN-EEERERIEKAGGrvsnG 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170 162 NHPQRNVVMRVLGDFD----IDPRPDISVRRAHPADRWL-LCSDGLCGVLEDSTIEETMTTLSDQG---ECAQRLVQMAL 233
Cdd:cd00143 160 RVPGVLAVTRALGDFDlkpgVSAEPDVTVVKLTEDDDFLiLASDGLWDVLSNQEAVDIVRSELAKEdlqEAAQELVDLAL 239
                       250
                ....*....|....
gi 23465170 234 RAGSTDNVTAVIAD 247
Cdd:cd00143 240 RRGSHDNITVVVVR 253
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
5-247 3.79e-69

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


Pssm-ID: 223704  Cd Length: 262  Bit Score: 225.70  E-value: 3.79e-69
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   5 AASQPLFLYSTTVSDVGTVRANNQDSSFAGEH-------LIAMCDGMGGHAGGDTASSIAIRSLAH-IEQDDTGGNVETI 76
Cdd:COG0631   1 SSSGILSLKVAGLSDVGTVRKHNEDAFLIKPNengnlllLFAVADGMGGHAAGEVASKLAVEALARlFDETNFNSLNESL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  77 SRMMETSVMAAHDAIVGKAKRERKLAGMGTTVTAVALVAGYWVIAHIGDSRAYLLRDGRLSRITCDHSYVQHLINTGRIT 156
Cdd:COG0631  81 EELLKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIIT 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170 157 PSEAKNHPQRNVVMRVLGDFDiDPRPDISVRRAHPADRWLLCSDGLCGVLEDSTIEETMTTLSDQGECAQRLVQMALRAG 236
Cdd:COG0631 161 PEEARSHPRRNALTRALGDFD-LLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNSETPQEAADKLIELALEGG 239
                       250
                ....*....|.
gi 23465170 237 STDNVTAVIAD 247
Cdd:COG0631 240 GPDNITVVLVR 250
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
17-245 1.71e-30

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 119.40  E-value: 1.71e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170     17 VSDVGTVRANNQDSSFA------GEHLIAMCDGMGGHAggdtASSIAIRSLAHI---EQDDTGGNVETISRMMETSVMAA 87
Cdd:smart00332  13 LSSMQGVRKPMEDAHVItpdlsdSGGFFGVFDGHGGSE----AAKFLSKNLPEIlaeELIKEKDELEDVEEALRKAFLST 88
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170     88 HDAIVGKAKrerklAGMGTTVTAVALVAGYWVIAHIGDSRAYLLRDGRLSRITCDHSyVQHLINTGRITPSEAKNHPQRN 167
Cdd:smart00332  89 DEEILEELE-----ALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHK-PSNEDERARIEAAGGFVINGRV 162
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170    168 ----VVMRVLGDFDIDP----RPDISVRRAHPADRWL-LCSDGLCGVLEDSTIEE--TMTTLSDQGECAQRLVQMALRAG 236
Cdd:smart00332 163 ngvlALSRAIGDFFLKPyvsaEPDVTVVELTEKDDFLiLASDGLWDVLSNQEVVDivRKHLSKDPKEAAKRLIDLALARG 242

                   ....*....
gi 23465170    237 STDNVTAVI 245
Cdd:smart00332 243 SKDNITVVV 251
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
35-241 1.91e-14

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 72.01  E-value: 1.91e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170    35 EHLIAMCDGMGGHAGGDTASSIAIRSLAHIEQDDTGGNVETIsrmMETSVMAAHDAIVGKAKRERKLaGMGTTVTaVALV 114
Cdd:pfam00481  34 WSFFAVFDGHGGSEAAKYAGKHLHTILALRRSFLTLRKLEDA---LRESFLETDEELRSDAANHEDL-SSGSTAV-VALI 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   115 AGY-WVIAHIGDSRAYLLRDG----RLS------------RITCDHSYVqhlINTGRITPSEAknhpqrnvVMRVLGDFD 177
Cdd:pfam00481 109 RGNkLYVANVGDSRAVLCRNGgaikQLTedhkpsdederrRIRAAGGFV---SRNGRVNGVLA--------VSRAFGDFD 177
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 23465170   178 IDPR-------PDISVRRAHPADRWL-LCSDGLCGVLED----STIEETMTTLSDQGECAQRLVQMALRAGSTDNV 241
Cdd:pfam00481 178 LKPGeqpvsaePDITSHKITEDDEFLiLACDGLWDVLSDqevvDIVRSNLSDGGDPMEAAEKLVDEAIAYGSEDNI 253
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
18-244 3.28e-20

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 93.20  E-value: 3.28e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   18 SDVGTVRANNQD-----------SSFAGEHLIA-----MCDGMGGHAGGDTASSIAIRSLAHIEQD---DTGGNVETIsr 78
Cdd:PRK14559 381 TDVGRQRHHNEDyfgintriqklENPHGRIVQArglyiLCDGMGGHAAGEVASALAVETLQQYFQQhwqDELPDEETI-- 458
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   79 mmETSVMAAHDAI--VGKAKRERKLAGMGTTVTAvALVAGYWV-IAHIGDSRAY-LLRDGRLSRITCDHSYVQHLINTGr 154
Cdd:PRK14559 459 --REAIYLANEAIydLNQQNARSGSGRMGTTLVM-ALVQDTQVaVAHVGDSRLYrVTRKGGLEQLTVDHEVGQREIQRG- 534
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  155 ITPSEAKNHPQRNVVMRVLGdfdidPR------PDISVRRAHPADRWLLCSDGLCG--VLEDSTIEETMTTLS-----DQ 221
Cdd:PRK14559 535 VEPQIAYARPDAYQLTQALG-----PRdnsaiqPDIQFLEIEEDTLLLLCSDGLSDndLLETHWQTHLLPLLSssanlDQ 609
                        250       260
                 ....*....|....*....|...
gi 23465170  222 GecAQRLVQMALRAGSTDNVTAV 244
Cdd:PRK14559 610 G--LNKLIDLANQYNGHDNITAI 630
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
1-319 1.93e-06

protein phosphatase 2C; Provisional


Pssm-ID: 240318 [Multi-domain]  Cd Length: 381  Bit Score: 49.00  E-value: 1.93e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170    1 MPKSAASQPLFLYSTTVSDVGTVRANNQDSSFAGEHLIAMCDGMG------GHAGGDTASSIA--IRSLAHIEQDDTggn 72
Cdd:PTZ00224   5 LPKPVLSKLVDRAGNSIFRCASACVNGYRESMEDAHLLYLTDDWGffgvfdGHVNDECSQYLAraWPQALEKEPEPM--- 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   73 veTISRMMETSVMAAHDAIvgKAKRERklagmGTTVTAVALVAGYWV-IAHIGDSRAYLLRDGRLSRITCDHS-----YV 146
Cdd:PTZ00224  82 --TDERMEELCLEIDEEWM--DSGREG-----GSTGTFCVIMKDVHLqVGNVGDSRVLVCRDGKLVFATEDHKpnnpgER 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  147 QHLINTG------RITPSEAknhpqrnvVMRVLGDFD-------------IDPRPDISVRRAHPADRWLLCSDGlcgVLE 207
Cdd:PTZ00224 153 QRIEACGgrvvsnRVDGDLA--------VSRAFGDRSfkvkgtgdyleqkVIAVPDVTHLTCQSNDFIILACDG---VFE 221
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  208 DS--------TIEETMTTLSDQGECAQRLVQMALRAGSTDNVTAVIADatLALDADAFDLPHQTPLVGGAAS-RNlepia 278
Cdd:PTZ00224 222 GNfsneevvaFVKEQLETCDDLAVVAGRVCDEAIRRGSKDNISCLIVQ--LKDGASYAKLFGHTSFVPGPPSpRR----- 294
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....
gi 23465170  279 divNEPVATAPALREDDSPAQRAAAL---IQPASAHEAETTQTT 319
Cdd:PTZ00224 295 ---NQPFRKAYAQMAEKGGTTTAAALekrYDLLKAFEKKTLNEQ 335
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
17-245 3.92e-05

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 44.52  E-value: 3.92e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   17 VSDVGTVRANNQDSSFAGehliaMCDGMGGHAGGDTASSIAIRSLAhieqDDTGGNVEtISRMMETSVMAAHDAIVGKAK 96
Cdd:PLN03145  90 MSDFGLKNSEDGPSAFYG-----VFDGHGGKHAADFACYHLPRFIV----EDEDFPRE-IEKVVSSAFLQTDTAFAEACS 159
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   97 RERKLAGmGTTVTAVALVAGYWVIAHIGDSRAYLLRDGRLSRITCDHSYVQHLiNTGRITPS-----EAKNHPQRNVVmR 171
Cdd:PLN03145 160 LDASLAS-GTTALAALVVGRSLVVANAGDCRAVLCRRGKAIEMSRDHKPMCSK-ERKRIEASggyvyDGYLNGQLNVA-R 236
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  172 VLGDFDID-----------PRPDISVRRAHPADRWLLCS-DGLCGVLEDST----IEETMTTLSDQGECAQRLVQMALRA 235
Cdd:PLN03145 237 ALGDWHMEgmkgsdggplsAEPELMTTQLTEEDEFLIIGcDGIWDVFRSQNavdfARRRLQEHNDPVMCSKELVDEALKR 316
                        250
                 ....*....|
gi 23465170  236 GSTDNVTAVI 245
Cdd:PLN03145 317 KSGDNLAVVV 326
 
Name Accession Description Interval E-value
PP2Cc cd00143
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
13-247 1.19e-51

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 238083  Cd Length: 254  Bit Score: 178.67  E-value: 1.19e-51
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  13 YSTTVSDVGTVRANNQDSSFA-------GEHLIAMCDGMGGHAGGDTASSIAIRSLAHIEQDDTGGNVETISRMMETSVM 85
Cdd:cd00143   1 FSAGVSDKGGDRKTNEDAVVIkpnlnneDGGLFGVFDGHGGHAAGEFASKLLVEELLEELEETLTLSEEDIEEALRKAFL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  86 AAHDAIVGKAKRERKLAGMGTTVTAVALVAGYWVIAHIGDSRAYLLRDGRLSRITCDHSYVQhLINTGRITPSEA----K 161
Cdd:cd00143  81 RADEEILEEAQDEPDDARSGTTAVVALIRGNKLYVANVGDSRAVLCRNGEAVQLTKDHKPVN-EEERERIEKAGGrvsnG 159
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170 162 NHPQRNVVMRVLGDFD----IDPRPDISVRRAHPADRWL-LCSDGLCGVLEDSTIEETMTTLSDQG---ECAQRLVQMAL 233
Cdd:cd00143 160 RVPGVLAVTRALGDFDlkpgVSAEPDVTVVKLTEDDDFLiLASDGLWDVLSNQEAVDIVRSELAKEdlqEAAQELVDLAL 239
                       250
                ....*....|....
gi 23465170 234 RAGSTDNVTAVIAD 247
Cdd:cd00143 240 RRGSHDNITVVVVR 253
PTC1 COG0631
Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];
5-247 3.79e-69

Serine/threonine protein phosphatase PrpC [Signal transduction mechanisms];


Pssm-ID: 223704  Cd Length: 262  Bit Score: 225.70  E-value: 3.79e-69
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   5 AASQPLFLYSTTVSDVGTVRANNQDSSFAGEH-------LIAMCDGMGGHAGGDTASSIAIRSLAH-IEQDDTGGNVETI 76
Cdd:COG0631   1 SSSGILSLKVAGLSDVGTVRKHNEDAFLIKPNengnlllLFAVADGMGGHAAGEVASKLAVEALARlFDETNFNSLNESL 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  77 SRMMETSVMAAHDAIVGKAKRERKLAGMGTTVTAVALVAGYWVIAHIGDSRAYLLRDGRLSRITCDHSYVQHLINTGRIT 156
Cdd:COG0631  81 EELLKEAILKANEAIAEEGQLNEDVRGMGTTLVLLLIRGNKLYVANVGDSRAYLLRDGELKQLTEDHSLVNRLEQRGIIT 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170 157 PSEAKNHPQRNVVMRVLGDFDiDPRPDISVRRAHPADRWLLCSDGLCGVLEDSTIEETMTTLSDQGECAQRLVQMALRAG 236
Cdd:COG0631 161 PEEARSHPRRNALTRALGDFD-LLEPDITELELEPGDFLLLCSDGLWDVVSDDEIVDILKNSETPQEAADKLIELALEGG 239
                       250
                ....*....|.
gi 23465170 237 STDNVTAVIAD 247
Cdd:COG0631 240 GPDNITVVLVR 250
PP2Cc smart00332
Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and ...
17-245 1.71e-30

Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence similarity.


Pssm-ID: 214625  Cd Length: 252  Bit Score: 119.40  E-value: 1.71e-30
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170     17 VSDVGTVRANNQDSSFA------GEHLIAMCDGMGGHAggdtASSIAIRSLAHI---EQDDTGGNVETISRMMETSVMAA 87
Cdd:smart00332  13 LSSMQGVRKPMEDAHVItpdlsdSGGFFGVFDGHGGSE----AAKFLSKNLPEIlaeELIKEKDELEDVEEALRKAFLST 88
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170     88 HDAIVGKAKrerklAGMGTTVTAVALVAGYWVIAHIGDSRAYLLRDGRLSRITCDHSyVQHLINTGRITPSEAKNHPQRN 167
Cdd:smart00332  89 DEEILEELE-----ALSGSTAVVALISGNKLYVANVGDSRAVLCRNGKAVQLTEDHK-PSNEDERARIEAAGGFVINGRV 162
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170    168 ----VVMRVLGDFDIDP----RPDISVRRAHPADRWL-LCSDGLCGVLEDSTIEE--TMTTLSDQGECAQRLVQMALRAG 236
Cdd:smart00332 163 ngvlALSRAIGDFFLKPyvsaEPDVTVVELTEKDDFLiLASDGLWDVLSNQEVVDivRKHLSKDPKEAAKRLIDLALARG 242

                   ....*....
gi 23465170    237 STDNVTAVI 245
Cdd:smart00332 243 SKDNITVVV 251
PP2C pfam00481
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
35-241 1.91e-14

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 249892  Cd Length: 253  Bit Score: 72.01  E-value: 1.91e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170    35 EHLIAMCDGMGGHAGGDTASSIAIRSLAHIEQDDTGGNVETIsrmMETSVMAAHDAIVGKAKRERKLaGMGTTVTaVALV 114
Cdd:pfam00481  34 WSFFAVFDGHGGSEAAKYAGKHLHTILALRRSFLTLRKLEDA---LRESFLETDEELRSDAANHEDL-SSGSTAV-VALI 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   115 AGY-WVIAHIGDSRAYLLRDG----RLS------------RITCDHSYVqhlINTGRITPSEAknhpqrnvVMRVLGDFD 177
Cdd:pfam00481 109 RGNkLYVANVGDSRAVLCRNGgaikQLTedhkpsdederrRIRAAGGFV---SRNGRVNGVLA--------VSRAFGDFD 177
                         170       180       190       200       210       220       230
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 23465170   178 IDPR-------PDISVRRAHPADRWL-LCSDGLCGVLED----STIEETMTTLSDQGECAQRLVQMALRAGSTDNV 241
Cdd:pfam00481 178 LKPGeqpvsaePDITSHKITEDDEFLiLACDGLWDVLSDqevvDIVRSNLSDGGDPMEAAEKLVDEAIAYGSEDNI 253
PP2C_2 pfam13672
Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine ...
25-202 3.54e-12

Protein phosphatase 2C; Protein phosphatase 2C is a Mn++ or Mg++ dependent protein serine/threonine phosphatase.


Pssm-ID: 257978  Cd Length: 210  Bit Score: 64.64  E-value: 3.54e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170    25 ANNQDSSFAGE----HLIAMCDGMGGHAGGDTASSIAIRSLAH-IEQDDTGGNVETIsrmmETSVMAAHDAIVGKAKRER 99
Cdd:pfam13672  10 LPCQDAFAYRVlsdgWLIAVADGAGSAKYSDVGARLAVEAAVEaLRELLDSGELPEL----EALVRQILNDILALVRQEA 85
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   100 KLAGM-----GTTVTAVALVAGYWVIAHIGDSR-AYLLRDGRLSRITCDHSYvQHLINTGRITPSEAknhpqrnvvmrvl 173
Cdd:pfam13672  86 AAQGLeprdyATTLLLAVITPGGIVFFQIGDGAiVVRDRDGELQLLSEPDSG-EYANETTFLTSPDA------------- 151
                         170       180
                  ....*....|....*....|....*....
gi 23465170   174 gdfdiDPRPDISVRRAHPADRWLLCSDGL 202
Cdd:pfam13672 152 -----LEEFRIRRLTLEPGDALALMTDGL 175
PP2C_SIG smart00331
Sigma factor PP2C-like phosphatases;
18-235 7.41e-11

Sigma factor PP2C-like phosphatases;


Pssm-ID: 214624  Cd Length: 193  Bit Score: 60.44  E-value: 7.41e-11
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170     18 SDVGTVRANNQDSSF------------AGEHLIAMCDGMGGHAGGDtASSIAIRSLAHIEQDDTGGNVETISRMMetsvm 85
Cdd:smart00331   1 DDGGLIAQYYEDATQvggdfydvvklpEGRLLIAIADVMGKGLAAA-LAMSMARSALRTLLSEGISLSQILERLN----- 74
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170     86 aahdaivgKAKRERKLAGMGTTVTA--VALVAGYWVIAHIGDSRAYLLRDgrlsritcDHSYVQHLINTGRitpseaknh 163
Cdd:smart00331  75 --------RAIYENGEDGMFATLFLalYDFAGGTLSYANAGHSPPYLLRA--------DGGLVEDLDDLGA--------- 129
                          170       180       190       200       210       220       230
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 23465170    164 pqrnvvmrVLGDFDiDPRPDISVRRAHPADRWLLCSDGLCGVLEDSTIEETMTTLsdQGECAQRLVQMALRA 235
Cdd:smart00331 130 --------PLGLEP-DVEVDVRELTLEPGDLLLLYTDGLTEARNPERLEELLEEL--LGSPPAEIAQRILEE 190
PRK14559 PRK14559
putative protein serine/threonine phosphatase; Provisional
18-244 3.28e-20

putative protein serine/threonine phosphatase; Provisional


Pssm-ID: 237756 [Multi-domain]  Cd Length: 645  Bit Score: 93.20  E-value: 3.28e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   18 SDVGTVRANNQD-----------SSFAGEHLIA-----MCDGMGGHAGGDTASSIAIRSLAHIEQD---DTGGNVETIsr 78
Cdd:PRK14559 381 TDVGRQRHHNEDyfgintriqklENPHGRIVQArglyiLCDGMGGHAAGEVASALAVETLQQYFQQhwqDELPDEETI-- 458
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   79 mmETSVMAAHDAI--VGKAKRERKLAGMGTTVTAvALVAGYWV-IAHIGDSRAY-LLRDGRLSRITCDHSYVQHLINTGr 154
Cdd:PRK14559 459 --REAIYLANEAIydLNQQNARSGSGRMGTTLVM-ALVQDTQVaVAHVGDSRLYrVTRKGGLEQLTVDHEVGQREIQRG- 534
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  155 ITPSEAKNHPQRNVVMRVLGdfdidPR------PDISVRRAHPADRWLLCSDGLCG--VLEDSTIEETMTTLS-----DQ 221
Cdd:PRK14559 535 VEPQIAYARPDAYQLTQALG-----PRdnsaiqPDIQFLEIEEDTLLLLCSDGLSDndLLETHWQTHLLPLLSssanlDQ 609
                        250       260
                 ....*....|....*....|...
gi 23465170  222 GecAQRLVQMALRAGSTDNVTAV 244
Cdd:PRK14559 610 G--LNKLIDLANQYNGHDNITAI 630
PTZ00224 PTZ00224
protein phosphatase 2C; Provisional
1-319 1.93e-06

protein phosphatase 2C; Provisional


Pssm-ID: 240318 [Multi-domain]  Cd Length: 381  Bit Score: 49.00  E-value: 1.93e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170    1 MPKSAASQPLFLYSTTVSDVGTVRANNQDSSFAGEHLIAMCDGMG------GHAGGDTASSIA--IRSLAHIEQDDTggn 72
Cdd:PTZ00224   5 LPKPVLSKLVDRAGNSIFRCASACVNGYRESMEDAHLLYLTDDWGffgvfdGHVNDECSQYLAraWPQALEKEPEPM--- 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   73 veTISRMMETSVMAAHDAIvgKAKRERklagmGTTVTAVALVAGYWV-IAHIGDSRAYLLRDGRLSRITCDHS-----YV 146
Cdd:PTZ00224  82 --TDERMEELCLEIDEEWM--DSGREG-----GSTGTFCVIMKDVHLqVGNVGDSRVLVCRDGKLVFATEDHKpnnpgER 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  147 QHLINTG------RITPSEAknhpqrnvVMRVLGDFD-------------IDPRPDISVRRAHPADRWLLCSDGlcgVLE 207
Cdd:PTZ00224 153 QRIEACGgrvvsnRVDGDLA--------VSRAFGDRSfkvkgtgdyleqkVIAVPDVTHLTCQSNDFIILACDG---VFE 221
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  208 DS--------TIEETMTTLSDQGECAQRLVQMALRAGSTDNVTAVIADatLALDADAFDLPHQTPLVGGAAS-RNlepia 278
Cdd:PTZ00224 222 GNfsneevvaFVKEQLETCDDLAVVAGRVCDEAIRRGSKDNISCLIVQ--LKDGASYAKLFGHTSFVPGPPSpRR----- 294
                        330       340       350       360
                 ....*....|....*....|....*....|....*....|....
gi 23465170  279 divNEPVATAPALREDDSPAQRAAAL---IQPASAHEAETTQTT 319
Cdd:PTZ00224 295 ---NQPFRKAYAQMAEKGGTTTAAALekrYDLLKAFEKKTLNEQ 335
PLN03145 PLN03145
Protein phosphatase 2c; Provisional
17-245 3.92e-05

Protein phosphatase 2c; Provisional


Pssm-ID: 215603 [Multi-domain]  Cd Length: 365  Bit Score: 44.52  E-value: 3.92e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   17 VSDVGTVRANNQDSSFAGehliaMCDGMGGHAGGDTASSIAIRSLAhieqDDTGGNVEtISRMMETSVMAAHDAIVGKAK 96
Cdd:PLN03145  90 MSDFGLKNSEDGPSAFYG-----VFDGHGGKHAADFACYHLPRFIV----EDEDFPRE-IEKVVSSAFLQTDTAFAEACS 159
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170   97 RERKLAGmGTTVTAVALVAGYWVIAHIGDSRAYLLRDGRLSRITCDHSYVQHLiNTGRITPS-----EAKNHPQRNVVmR 171
Cdd:PLN03145 160 LDASLAS-GTTALAALVVGRSLVVANAGDCRAVLCRRGKAIEMSRDHKPMCSK-ERKRIEASggyvyDGYLNGQLNVA-R 236
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  172 VLGDFDID-----------PRPDISVRRAHPADRWLLCS-DGLCGVLEDST----IEETMTTLSDQGECAQRLVQMALRA 235
Cdd:PLN03145 237 ALGDWHMEgmkgsdggplsAEPELMTTQLTEEDEFLIIGcDGIWDVFRSQNavdfARRRLQEHNDPVMCSKELVDEALKR 316
                        250
                 ....*....|
gi 23465170  236 GSTDNVTAVI 245
Cdd:PLN03145 317 KSGDNLAVVV 326
PRK14971 PRK14971
DNA polymerase III subunits gamma and tau; Provisional
262-386 6.77e-05

DNA polymerase III subunits gamma and tau; Provisional


Pssm-ID: 237874 [Multi-domain]  Cd Length: 614  Bit Score: 44.38  E-value: 6.77e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 23465170  262 QTPLVGGAASRNLEP---IADIVNEPVA-TAPALREDDSPAQR----AAALIQPASAHEAETTQTTA---KPSSTRVVQP 330
Cdd:PRK14971 361 QLTQKGDDASGGRGPkqhIKPVFTQPAAaPQPSAAAAASPSPSqssaAAQPSAPQSATQPAGTPPTVsvdPPAAVPVNPP 440
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 23465170  331 STVREETGERANPDTGEIPVVQKPD-GRLSADPNDPDVAKAirdEQVEQKKATRTKK 386
Cdd:PRK14971 441 STAPQAVRPAQFKEEKKIPVSKVSSlGPSTLRPIQEKAEQA---TGNIKEAPTGTQK 494
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH