NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|226958308|ref|NP_001034297.2|]
View 

protein spinster homolog 1

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
62-450 1.17e-27

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


:

Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 112.79  E-value: 1.17e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  62 VVVLCYINLLNYMDRFTVAGVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLG 141
Cdd:cd06174    1 LLLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308 142 SSFIPreHFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAGdWHWALR 221
Cdd:cd06174   81 LAFAS--SLWLLLVGRFLLGLGGGALYPAAAALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLG-WRWLFL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308 222 VtpglgvlavlllflvvqepprgaverhsgSPPLSPTSWWADLKALarnPSFVLSSLGFTAVAFVTGSLALWAPAFLLRS 301
Cdd:cd06174  158 I-----------------------------LAILGLLLALLLLFLL---RLLLLLALAFFLLSFGYYGLLTYLPLYLQEV 205
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308 302 RVVlgetppclpgdscSSSDSLIFGLITCLTGVLGVGLGVEISRRLRRFNpradPLVCAAGLLGSSPFLFLSLACARGSI 381
Cdd:cd06174  206 LGL-------------SAAEAGLLLSLFGLGGILGALLGGLLSDRLGRRR----LLLLIGLLLAALGLLLLALAPSLALL 268
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 226958308 382 VATYIFIFIGETLLSMNWAIVADILLYvviPTRRSTAEAFqIVLSHLLGDAGSPYLIGLISDRLRRSWP 450
Cdd:cd06174  269 LVALLLLGFGLGFAFPALLTLASELAP---PEARGTASGL-FNTFGSLGGALGPLLAGLLLDTGGYGGV 333
MFS_1 pfam07690
Major Facilitator Superfamily;
65-418 3.69e-21

Major Facilitator Superfamily;


:

Pssm-ID: 254360 [Multi-domain]  Cd Length: 346  Bit Score: 93.64  E-value: 3.69e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   65 LCYINLLNYMDRFTVAGVL-TDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSS 143
Cdd:pfam07690   1 LFLAAFLAGLGRSLLGPALpLYLAEDLGISPTEIGLLLTAFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  144 FIPreHFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAGdWHWALRVT 223
Cdd:pfam07690  81 FAS--SLWLLLVLRVLQGLGGGALFPAAAALIADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLFG-WRAAFLIL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  224 PGLGVLAVLLLFLVVQEPPRGavERHSGSPPLSPTSWWADLKALARNPSFVLsSLGFTAVAFVTGSLALWAPAFLLRSRV 303
Cdd:pfam07690 158 AILALLAAVLAALLLPRPPPE--SKRPKPAEEAPAPLLPAWKLLLRDPVLWL-LLALLLFGFAFFALLTYLPLYQEVLGL 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  304 vlgetppclpgdscSSSDSLIFGLITCLTGVLGVGLGVEISRRLRRFNPRAdpLVCAAGLLGSSPFLFLSLACARGSIVA 383
Cdd:pfam07690 235 --------------SALLAGLLLGLAGLLGAIGRLLLGRLSDRLGRRRRLL--LALLLLILAALGLALLSLTESSLWLLL 298
                         330       340       350
                  ....*....|....*....|....*....|....*
gi 226958308  384 TYIFIFIGetlLSMNWAIVADILLYVVIPTRRSTA 418
Cdd:pfam07690 299 ALLLLGFG---FGLVFPALNALVSDLAPKEERGTA 330
 
Name Accession Description Interval E-value
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
62-450 1.17e-27

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 112.79  E-value: 1.17e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  62 VVVLCYINLLNYMDRFTVAGVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLG 141
Cdd:cd06174    1 LLLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308 142 SSFIPreHFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAGdWHWALR 221
Cdd:cd06174   81 LAFAS--SLWLLLVGRFLLGLGGGALYPAAAALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLG-WRWLFL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308 222 VtpglgvlavlllflvvqepprgaverhsgSPPLSPTSWWADLKALarnPSFVLSSLGFTAVAFVTGSLALWAPAFLLRS 301
Cdd:cd06174  158 I-----------------------------LAILGLLLALLLLFLL---RLLLLLALAFFLLSFGYYGLLTYLPLYLQEV 205
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308 302 RVVlgetppclpgdscSSSDSLIFGLITCLTGVLGVGLGVEISRRLRRFNpradPLVCAAGLLGSSPFLFLSLACARGSI 381
Cdd:cd06174  206 LGL-------------SAAEAGLLLSLFGLGGILGALLGGLLSDRLGRRR----LLLLIGLLLAALGLLLLALAPSLALL 268
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 226958308 382 VATYIFIFIGETLLSMNWAIVADILLYvviPTRRSTAEAFqIVLSHLLGDAGSPYLIGLISDRLRRSWP 450
Cdd:cd06174  269 LVALLLLGFGLGFAFPALLTLASELAP---PEARGTASGL-FNTFGSLGGALGPLLAGLLLDTGGYGGV 333
2_A_01_02 TIGR00880
Multidrug resistance protein;
102-218 4.01e-11

Multidrug resistance protein;


Pssm-ID: 273318  Cd Length: 141  Bit Score: 60.74  E-value: 4.01e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  102 TVFISSY----MVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPreHFWLLLLTRGLVGVGEASYSTIAPTLIAD 177
Cdd:TIGR00880   1 GLLLAGYalgqLIYSPLSGLLTDRFGRKPVLLVGLFIFVLSTAMFALSS--NITVLIIARFLQGFGAAFALVAGAALIAD 78
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 226958308  178 LFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAGdWHW 218
Cdd:TIGR00880  79 IYPPEERGVALGLMSAGIALGPLLGPPLGGVLAQFLG-WRA 118
MFS_1 pfam07690
Major Facilitator Superfamily;
65-418 3.69e-21

Major Facilitator Superfamily;


Pssm-ID: 254360 [Multi-domain]  Cd Length: 346  Bit Score: 93.64  E-value: 3.69e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   65 LCYINLLNYMDRFTVAGVL-TDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSS 143
Cdd:pfam07690   1 LFLAAFLAGLGRSLLGPALpLYLAEDLGISPTEIGLLLTAFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  144 FIPreHFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAGdWHWALRVT 223
Cdd:pfam07690  81 FAS--SLWLLLVLRVLQGLGGGALFPAAAALIADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLFG-WRAAFLIL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  224 PGLGVLAVLLLFLVVQEPPRGavERHSGSPPLSPTSWWADLKALARNPSFVLsSLGFTAVAFVTGSLALWAPAFLLRSRV 303
Cdd:pfam07690 158 AILALLAAVLAALLLPRPPPE--SKRPKPAEEAPAPLLPAWKLLLRDPVLWL-LLALLLFGFAFFALLTYLPLYQEVLGL 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  304 vlgetppclpgdscSSSDSLIFGLITCLTGVLGVGLGVEISRRLRRFNPRAdpLVCAAGLLGSSPFLFLSLACARGSIVA 383
Cdd:pfam07690 235 --------------SALLAGLLLGLAGLLGAIGRLLLGRLSDRLGRRRRLL--LALLLLILAALGLALLSLTESSLWLLL 298
                         330       340       350
                  ....*....|....*....|....*....|....*
gi 226958308  384 TYIFIFIGetlLSMNWAIVADILLYVVIPTRRSTA 418
Cdd:pfam07690 299 ALLLLGFG---FGLVFPALNALVSDLAPKEERGTA 330
2A0114 TIGR00893
D-galactonate transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, ...
71-406 2.79e-12

D-galactonate transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273326 [Multi-domain]  Cd Length: 399  Bit Score: 66.98  E-value: 2.79e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   71 LNYMDRFTVAGVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIprEHF 150
Cdd:TIGR00893   5 INYLDRANLSFAAPMLQEDLGLSAAQYGYVFSAFSWGYVVGQFPGGWLLDRFGARKTLAVFIVIWGVFTGLQAFA--GAY 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  151 WLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGY-IAGSKVkdLAGDWHWALRVTPGLGVL 229
Cdd:TIGR00893  83 VSLYILRVLLGAAEAPFFPGIILIVASWFPASERATAVSIFNSAQGLGGIIGGpLVGWIL--IHFSWQWAFIIEGVLGII 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  230 AVLLLFLVVQEPP----------------RGAVERHSGSPplsPTSWWADLKALARNPSFVLSSLGFTAVAFVTGSLALW 293
Cdd:TIGR00893 161 WGVLWLKFIPDPPqkakwlteeekyivvgGLLAEQQGKGP---STPKKYQIKELLKDRRVWGLALGQFLVNIGLGFFLTW 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  294 APAFLLRSRVVlgetppclpgdscSSSDSLIFGLITCLTGVLGVGLGVEIS-RRLRRFNP--RADPLVCAAGLLGSSPFL 370
Cdd:TIGR00893 238 FPTYLVQERGL-------------SILEAGFMASLPGIVGFIGMILGGRLSdLLLRRGKSlvFARKTAIIAGLVLSLLMF 304
                         330       340       350
                  ....*....|....*....|....*....|....*.
gi 226958308  371 FLSLACARGSIVATYIFIFIGETLLSMNWAIVADIL 406
Cdd:TIGR00893 305 ATNYVNIPYAALALVALGFFGLGAGAIGWALISDNA 340
AraJ COG2814
Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];
74-219 1.72e-10

Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];


Pssm-ID: 225371 [Multi-domain]  Cd Length: 394  Bit Score: 61.48  E-value: 1.72e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  74 MDRFTVAGVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPreHFWLL 153
Cdd:COG2814   27 TTEFVPVGLLPPIAADLGVSEGAAGQLITAYALGVALGAPLLALLTGRLERRRLLLGLLALFIVSNLLSALAP--SFAVL 104
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 226958308 154 LLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAGdWHWA 219
Cdd:COG2814  105 LLARALAGLAHGVFWSIAAALAARLVPPGKRGRALALVFTGLTLATVLGVPLGTFLGQLFG-WRAT 169
PRK03893 PRK03893
putative sialic acid transporter; Provisional
70-165 3.19e-04

putative sialic acid transporter; Provisional


Pssm-ID: 179668 [Multi-domain]  Cd Length: 496  Bit Score: 41.99  E-value: 3.19e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  70 LLNYMDRFTVAGVLTDIEQFFNIGD-GSTGLIQTVFISSYMVlAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPre 148
Cdd:PRK03893  30 LLDGFDFVLITLVLTEVQGEFGLTTvQAASLISAAFISRWFG-GLLLGAMGDRYGRRLAMVISIVLFSVGTLACGFAP-- 106
                         90
                 ....*....|....*..
gi 226958308 149 HFWLLLLTRGLVGVGEA 165
Cdd:PRK03893 107 GYWTLFIARLVIGMGMA 123
 
Name Accession Description Interval E-value
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
62-450 1.17e-27

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 112.79  E-value: 1.17e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  62 VVVLCYINLLNYMDRFTVAGVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLG 141
Cdd:cd06174    1 LLLLFLGFFLSGLDRGLLSPALPLLAEDLGLSASQAGLIVSAFSLGYALGSLLAGYLSDRFGRRRVLLLGLLLFALGSLL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308 142 SSFIPreHFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAGdWHWALR 221
Cdd:cd06174   81 LAFAS--SLWLLLVGRFLLGLGGGALYPAAAALIAEWFPPKERGRALGLFSAGFGLGALLGPLLGGLLAESLG-WRWLFL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308 222 VtpglgvlavlllflvvqepprgaverhsgSPPLSPTSWWADLKALarnPSFVLSSLGFTAVAFVTGSLALWAPAFLLRS 301
Cdd:cd06174  158 I-----------------------------LAILGLLLALLLLFLL---RLLLLLALAFFLLSFGYYGLLTYLPLYLQEV 205
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308 302 RVVlgetppclpgdscSSSDSLIFGLITCLTGVLGVGLGVEISRRLRRFNpradPLVCAAGLLGSSPFLFLSLACARGSI 381
Cdd:cd06174  206 LGL-------------SAAEAGLLLSLFGLGGILGALLGGLLSDRLGRRR----LLLLIGLLLAALGLLLLALAPSLALL 268
                        330       340       350       360       370       380
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 226958308 382 VATYIFIFIGETLLSMNWAIVADILLYvviPTRRSTAEAFqIVLSHLLGDAGSPYLIGLISDRLRRSWP 450
Cdd:cd06174  269 LVALLLLGFGLGFAFPALLTLASELAP---PEARGTASGL-FNTFGSLGGALGPLLAGLLLDTGGYGGV 333
2_A_01_02 TIGR00880
Multidrug resistance protein;
102-218 4.01e-11

Multidrug resistance protein;


Pssm-ID: 273318  Cd Length: 141  Bit Score: 60.74  E-value: 4.01e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  102 TVFISSY----MVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPreHFWLLLLTRGLVGVGEASYSTIAPTLIAD 177
Cdd:TIGR00880   1 GLLLAGYalgqLIYSPLSGLLTDRFGRKPVLLVGLFIFVLSTAMFALSS--NITVLIIARFLQGFGAAFALVAGAALIAD 78
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
gi 226958308  178 LFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAGdWHW 218
Cdd:TIGR00880  79 IYPPEERGVALGLMSAGIALGPLLGPPLGGVLAQFLG-WRA 118
MFS cd06174
The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters ...
61-220 2.28e-07

The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of substrates including ions, sugar phosphates, drugs, neurotransmitters, nucleosides, amino acids, and peptides. They do so using the electrochemical potential of the transported substrates. Uniporters transport a single substrate, while symporters and antiporters transport two substrates in the same or in opposite directions, respectively, across membranes. MFS proteins are typically 400 to 600 amino acids in length, and the majority contain 12 transmembrane alpha helices (TMs) connected by hydrophilic loops. The N- and C-terminal halves of these proteins display weak similarity and may be the result of a gene duplication/fusion event. Based on kinetic studies and the structures of a few bacterial superfamily members, GlpT (glycerol-3-phosphate transporter), LacY (lactose permease), and EmrD (multidrug transporter), MFS proteins are thought to function through a single substrate binding site, alternating-access mechanism involving a rocker-switch type of movement. Bacterial members function primarily for nutrient uptake, and as drug-efflux pumps to confer antibiotic resistance. Some MFS proteins have medical significance in humans such as the glucose transporter Glut4, which is impaired in type II diabetes, and glucose-6-phosphate transporter (G6PT), which causes glycogen storage disease when mutated.


Pssm-ID: 119392 [Multi-domain]  Cd Length: 352  Bit Score: 51.55  E-value: 2.28e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  61 IVVVLCYINLLNYMDRFTVAGVLTDI-EQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKY-LMCGGIAFWSLV 138
Cdd:cd06174  176 LLLLLALAFFLLSFGYYGLLTYLPLYlQEVLGLSAAEAGLLLSLFGLGGILGALLGGLLSDRLGRRRlLLLIGLLLAALG 255
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308 139 TLGSSFIPreHFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDlAGDWHW 218
Cdd:cd06174  256 LLLLALAP--SLALLLVALLLLGFGLGFAFPALLTLASELAPPEARGTASGLFNTFGSLGGALGPLLAGLLLD-TGGYGG 332

                 ..
gi 226958308 219 AL 220
Cdd:cd06174  333 VF 334
MFS_1 pfam07690
Major Facilitator Superfamily;
65-418 3.69e-21

Major Facilitator Superfamily;


Pssm-ID: 254360 [Multi-domain]  Cd Length: 346  Bit Score: 93.64  E-value: 3.69e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   65 LCYINLLNYMDRFTVAGVL-TDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSS 143
Cdd:pfam07690   1 LFLAAFLAGLGRSLLGPALpLYLAEDLGISPTEIGLLLTAFSLGYALAQPLAGRLSDRFGRRRVLLIGLLLFALGLLLLL 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  144 FIPreHFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAGdWHWALRVT 223
Cdd:pfam07690  81 FAS--SLWLLLVLRVLQGLGGGALFPAAAALIADWFPPEERGRALGLLSAGFGLGAALGPLLGGLLASLFG-WRAAFLIL 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  224 PGLGVLAVLLLFLVVQEPPRGavERHSGSPPLSPTSWWADLKALARNPSFVLsSLGFTAVAFVTGSLALWAPAFLLRSRV 303
Cdd:pfam07690 158 AILALLAAVLAALLLPRPPPE--SKRPKPAEEAPAPLLPAWKLLLRDPVLWL-LLALLLFGFAFFALLTYLPLYQEVLGL 234
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  304 vlgetppclpgdscSSSDSLIFGLITCLTGVLGVGLGVEISRRLRRFNPRAdpLVCAAGLLGSSPFLFLSLACARGSIVA 383
Cdd:pfam07690 235 --------------SALLAGLLLGLAGLLGAIGRLLLGRLSDRLGRRRRLL--LALLLLILAALGLALLSLTESSLWLLL 298
                         330       340       350
                  ....*....|....*....|....*....|....*
gi 226958308  384 TYIFIFIGetlLSMNWAIVADILLYVVIPTRRSTA 418
Cdd:pfam07690 299 ALLLLGFG---FGLVFPALNALVSDLAPKEERGTA 330
2A0114 TIGR00893
D-galactonate transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, ...
71-406 2.79e-12

D-galactonate transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273326 [Multi-domain]  Cd Length: 399  Bit Score: 66.98  E-value: 2.79e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   71 LNYMDRFTVAGVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIprEHF 150
Cdd:TIGR00893   5 INYLDRANLSFAAPMLQEDLGLSAAQYGYVFSAFSWGYVVGQFPGGWLLDRFGARKTLAVFIVIWGVFTGLQAFA--GAY 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  151 WLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGY-IAGSKVkdLAGDWHWALRVTPGLGVL 229
Cdd:TIGR00893  83 VSLYILRVLLGAAEAPFFPGIILIVASWFPASERATAVSIFNSAQGLGGIIGGpLVGWIL--IHFSWQWAFIIEGVLGII 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  230 AVLLLFLVVQEPP----------------RGAVERHSGSPplsPTSWWADLKALARNPSFVLSSLGFTAVAFVTGSLALW 293
Cdd:TIGR00893 161 WGVLWLKFIPDPPqkakwlteeekyivvgGLLAEQQGKGP---STPKKYQIKELLKDRRVWGLALGQFLVNIGLGFFLTW 237
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  294 APAFLLRSRVVlgetppclpgdscSSSDSLIFGLITCLTGVLGVGLGVEIS-RRLRRFNP--RADPLVCAAGLLGSSPFL 370
Cdd:TIGR00893 238 FPTYLVQERGL-------------SILEAGFMASLPGIVGFIGMILGGRLSdLLLRRGKSlvFARKTAIIAGLVLSLLMF 304
                         330       340       350
                  ....*....|....*....|....*....|....*.
gi 226958308  371 FLSLACARGSIVATYIFIFIGETLLSMNWAIVADIL 406
Cdd:TIGR00893 305 ATNYVNIPYAALALVALGFFGLGAGAIGWALISDNA 340
2A0104 TIGR00881
phosphoglycerate transporter family protein; [Transport and binding proteins, Carbohydrates, ...
70-309 1.06e-10

phosphoglycerate transporter family protein; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273319 [Multi-domain]  Cd Length: 379  Bit Score: 62.01  E-value: 1.06e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   70 LLNYMDRFTVAGVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPreH 149
Cdd:TIGR00881   5 AAYYLVRKNFALAMPYLVEEIGLSKTDLGLLLSSFSIAYGISKFVMGSVSDRSNPRVFLPIGLILCAIVNLFFGFST--S 82
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  150 FWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAGDWHWALRVTPGLGVL 229
Cdd:TIGR00881  83 LWVMAALWALNGIFQGMGWPPCGRTVTKWFSRSERGTWVSFWNCSHNVGGGLLPPLVLFGIAELYSWHWVFIVPGIIAII 162
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  230 AVLLLFLVVQEPPRG------------AVERHSGSPPLSPTSWWADLKALARNPSFVLSSLGFTAVAFVTGSLALWAPAF 297
Cdd:TIGR00881 163 VSLICFLLLRDSPQScglppaeempneEPDGDAEKKEEELTKKQIFLQYVLLNKVLWYISLGYVFVYVVRTGILDWSPLY 242
                         250
                  ....*....|..
gi 226958308  298 LLRSRVVLGETP 309
Cdd:TIGR00881 243 LTQEKGFSKEKA 254
AraJ COG2814
Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];
74-219 1.72e-10

Predicted arabinose efflux permease, MFS family [Carbohydrate transport and metabolism];


Pssm-ID: 225371 [Multi-domain]  Cd Length: 394  Bit Score: 61.48  E-value: 1.72e-10
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  74 MDRFTVAGVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPreHFWLL 153
Cdd:COG2814   27 TTEFVPVGLLPPIAADLGVSEGAAGQLITAYALGVALGAPLLALLTGRLERRRLLLGLLALFIVSNLLSALAP--SFAVL 104
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 226958308 154 LLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAGdWHWA 219
Cdd:COG2814  105 LLARALAGLAHGVFWSIAAALAARLVPPGKRGRALALVFTGLTLATVLGVPLGTFLGQLFG-WRAT 169
Sugar_tr pfam00083
Sugar (and other) transporter;
75-218 1.73e-10

Sugar (and other) transporter;


Pssm-ID: 249572 [Multi-domain]  Cd Length: 449  Bit Score: 61.55  E-value: 1.73e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   75 DRFTVAGVLTDIEQFFNIG-------DGSTGLIQTVFISSYMVLAPV----FGYLGDRYNRKYLMCGGIAFWSLVTLGSS 143
Cdd:pfam00083  14 DTGVIGAFLTLIKFFKRFGaltsigaDYLSTSLSGLIVSIFSVGCLIgslfAGKLGDRFGRKPSLLIANVLFVIGALLQG 93
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 226958308  144 FIPREHFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAGDWHW 218
Cdd:pfam00083  94 FAPGKSFYMLIVGRVIVGLGVGGISVLVPMYISEIAPKKLRGALGSLYQLGITFGILVAAIIGLGLNKYSNSDGW 168
2A0115 TIGR00895
benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and ...
60-372 5.74e-07

benzoate transport; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273327 [Multi-domain]  Cd Length: 398  Bit Score: 50.43  E-value: 5.74e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   60 LIVVVLCY-INLLNYMDRFTVAGVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLV 138
Cdd:TIGR00895  16 WRAIILSFlIMLMDGYDLAAMGFAAPAISAEWGLDPVQLGFLFSAGLIGMAFGALFFGPLADRIGRRRVLLWSILLFSVF 95
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  139 TLGSSFipREHFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVG-SGLGYIAGSKVKDLagDWH 217
Cdd:TIGR00895  96 TLLCAL--ATNVTQLLILRFLAGLGLGGLMPNLNALVSEYAPKRFRGTAVGLMFCGYPIGaAVGGFLAGWLIPVF--GWR 171
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  218 WALRVTPGLGVLAVLLLFLVVQEPPRGAVERHSGS-----PPLSPTSWWADLKALARNPSFVLSSLGFTAVAF----VTG 288
Cdd:TIGR00895 172 SLFYVGGIAPLLLLLLLMRFLPESIDFLVSKRPETvrrivNAIAPQMQAEAQSALPEQKSTQGTKRSVFKALFqgktARI 251
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  289 SLALWAPAFLLRSRV--VLGETPPCLPGDSCSSSDSLIFGLITCLTGVLGvglGVEISRRLRRFNPRadplVCAAGLLGS 366
Cdd:TIGR00895 252 TVLLWLLYFMLLVGVyfLTNWLPKLMVELGFSLSLAATGGALFNFGGVIG---SIIFGWLADRLGPR----VTALLLLLG 324

                  ....*.
gi 226958308  367 SPFLFL 372
Cdd:TIGR00895 325 AVFAVL 330
2A0119 TIGR00898
cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]
98-193 1.34e-06

cation transport protein; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 273328 [Multi-domain]  Cd Length: 505  Bit Score: 49.63  E-value: 1.34e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   98 GLIQTVFISSYMVLAPVFGYLGDRYNRKYLMcggiaFWS-LVTLGSSFI----PreHFWLLLLTRGLVGVGEASYSTIAP 172
Cdd:TIGR00898 130 DLTQSCFFVGVLLGSFVFGYLSDRFGRKKVL-----LLStLVTAVSGVLtafsP--NYTVFLVFRLLVGMGIGGIWVQAV 202
                          90       100
                  ....*....|....*....|..
gi 226958308  173 TLIADLFVADQRSRM-LSIFYF 193
Cdd:TIGR00898 203 VLNTEFLPKKQRAIVgTLIQVF 224
SP TIGR00879
MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of ...
89-220 8.02e-06

MFS transporter, sugar porter (SP) family; This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273317 [Multi-domain]  Cd Length: 481  Bit Score: 46.95  E-value: 8.02e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   89 FFNIGDGSTGLIQTVFISSYMVLAPVF----GYLGDRYNRK-YLMCGGIAFWSLVTLGSSFIPREHFWLLLLTRGLVGVG 163
Cdd:TIGR00879  61 TSANSDSYSSSLWGLVVSIFLVGGFIGalfaGWLSDRFGRKkSLLIIALLFVIGAILMGLAAFALSVEMLIVGRVLLGIG 140
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 226958308  164 EASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGS--KVKDLAGDWHWAL 220
Cdd:TIGR00879 141 VGIASALVPMYLSEIAPKALRGALTSLYQLAITFGILVAYGFGSgkVSLNNTLGWRIPL 199
MFS_2 pfam13347
MFS/sugar transport protein; This family is part of the major facilitator superfamily of ...
94-202 2.32e-05

MFS/sugar transport protein; This family is part of the major facilitator superfamily of membrane transport proteins.


Pssm-ID: 257676 [Multi-domain]  Cd Length: 423  Bit Score: 45.27  E-value: 2.32e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   94 DGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPREHFWLLLLTRGLVGVGEASYSTIAPT 173
Cdd:pfam13347 254 AGLFSVLLLIGTIAAILGAPLWPWLAKRFGKKRTFLLGMLLAAIGLVLLFFLPPGSVWLFLVLVVLIGIGLGLATLLPWA 333
                          90       100       110
                  ....*....|....*....|....*....|....*.
gi 226958308  174 LIADLFVADQR---SRMLSIFY----FAIPVGSGLG 202
Cdd:pfam13347 334 MLADVVDYGEWktgKRREGIVFslysFADKLGGALG 369
2A0112 TIGR00891
putative sialic acid transporter; [Transport and binding proteins, Carbohydrates, organic ...
70-218 1.49e-04

putative sialic acid transporter; [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]


Pssm-ID: 273324 [Multi-domain]  Cd Length: 405  Bit Score: 42.95  E-value: 1.49e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   70 LLNYMDRFTVAGVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPreH 149
Cdd:TIGR00891  22 LLDAFDFFLVALVLAEVAGEFGLTTVDAASLISAALISRWFGALMFGLWGDRYGRRLPMVTSIVLFSAGTLACGFAP--G 99
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  150 FWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAGD-WHW 218
Cdd:TIGR00891 100 YITMFIARLVIGIGMGGEYGSSAAYVIESWPKHLRNKASGLLISGYAVGAVVAAQVYSLVVPVWGDgWRA 169
OATP pfam03137
Organic Anion Transporter Polypeptide (OATP) family; This family consists of several ...
59-207 1.55e-04

Organic Anion Transporter Polypeptide (OATP) family; This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules). Thus, Tamai et al. initiated the current scheme of using digits for rat OATPs and letters for human ones. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. Note: Members of this family are described (in the Swiss-Prot database) as belonging to the SLC21 family of transporters.


Pssm-ID: 251753 [Multi-domain]  Cd Length: 583  Bit Score: 43.06  E-value: 1.55e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   59 TLIVVVLCyinlLNYMDRFTVAG----VLTDIEQFFNIGDGSTGLIQTVF-ISSYMVLAPVfGYLGDRYNR-KYLMCGGI 132
Cdd:pfam03137   2 KVFLLLLG----LAALLQLLVNAyfksSITTIEKRFKISSSHSGIISSSYdIGNLLLIIFV-SYFGSKGHRpRWIGIGGL 76
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  133 --AFWSLV------------------------------TLGSSFIPRE--------------HFWLLLLTRGLVGVGEAS 166
Cdd:pfam03137  77 lmALGSLLtalphflsgpysyeqtnltgsnessnstlcTHGGALIPSPcqsegschkestslMWLLLFVGQLLRGIGATP 156
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|..
gi 226958308  167 YSTIAPTLIADlFVADQRS-RMLSIFYFAIPVGSGLGYIAGS 207
Cdd:pfam03137 157 IFTLGISYIDD-NVKSKNSpLYLGILFTMAMFGPAIGFLLGS 197
PRK03893 PRK03893
putative sialic acid transporter; Provisional
70-165 3.19e-04

putative sialic acid transporter; Provisional


Pssm-ID: 179668 [Multi-domain]  Cd Length: 496  Bit Score: 41.99  E-value: 3.19e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  70 LLNYMDRFTVAGVLTDIEQFFNIGD-GSTGLIQTVFISSYMVlAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPre 148
Cdd:PRK03893  30 LLDGFDFVLITLVLTEVQGEFGLTTvQAASLISAAFISRWFG-GLLLGAMGDRYGRRLAMVISIVLFSVGTLACGFAP-- 106
                         90
                 ....*....|....*..
gi 226958308 149 HFWLLLLTRGLVGVGEA 165
Cdd:PRK03893 107 GYWTLFIARLVIGMGMA 123
2A0121 TIGR00900
H+ Antiporter protein; [Transport and binding proteins, Cations and iron carrying compounds]
90-214 3.70e-04

H+ Antiporter protein; [Transport and binding proteins, Cations and iron carrying compounds]


Pssm-ID: 162098 [Multi-domain]  Cd Length: 365  Bit Score: 41.54  E-value: 3.70e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   90 FNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPrEHFWLLLLTRGLVGVGEASYST 169
Cdd:TIGR00900 242 LGRGSTHYGWVLAAFGLGALLGALLLGLLGRYFKRMALMTGAIFVIGLAILVVGLTP-PNFPLFLVLWFAIGVGYGPINV 320
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
gi 226958308  170 IAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDLAG 214
Cdd:TIGR00900 321 PQGTLLQRRVPAELLGRVFGAQFSLSHAAWPLGLILAGPLADHLG 365
ProP COG0477
MFS family permease [Carbohydrate transport and metabolism, Amino acid transport and ...
77-201 7.73e-04

MFS family permease [Carbohydrate transport and metabolism, Amino acid transport and metabolism, Inorganic ion transport and metabolism, General function prediction only];


Pssm-ID: 223553 [Multi-domain]  Cd Length: 338  Bit Score: 40.44  E-value: 7.73e-04
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  77 FTVAGVLTDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPREHFWLLLLT 156
Cdd:COG0477   21 LSPALPLLLSTLSLSSGRLLYGLLLSAFFLGYAIGSLLAGPLGDRYGRRKVLIIGLLLFLLGTLLLALAPNVGLALLLIL 100
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 226958308 157 RGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGL 201
Cdd:COG0477  101 RLLQGLGGGGLLPVASALLSEWFPEATERGLAVGLVTLGAGALGL 145
MFS_2 pfam13347
MFS/sugar transport protein; This family is part of the major facilitator superfamily of ...
253-408 2.16e-03

MFS/sugar transport protein; This family is part of the major facilitator superfamily of membrane transport proteins.


Pssm-ID: 257676 [Multi-domain]  Cd Length: 423  Bit Score: 39.11  E-value: 2.16e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  253 PPLSPTSWWADLKALARNPSFVLSSLGFTAVAFVtgsLALWAPAFLLRSRVVLGetppclpgdscSSSDSLIFGLITCLT 332
Cdd:pfam13347 202 PPKEKVSLRDMFKALFKNRPLLILLLLYLLNALA---MAVRNGLLLYYFTYVLG-----------NAGLFSVLLLIGTIA 267
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308  333 GVLGVGLGVEISRRLRRFNpradplVCAAGLLGSSPFLFLSLACARGSIVATYIFIFIGETLLSM----NWAIVADILLY 408
Cdd:pfam13347 268 AILGAPLWPWLAKRFGKKR------TFLLGMLLAAIGLVLLFFLPPGSVWLFLVLVVLIGIGLGLatllPWAMLADVVDY 341
synapt_SV2 TIGR01299
synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger ...
4-189 7.69e-03

synaptic vesicle protein SV2; This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.


Pssm-ID: 130366 [Multi-domain]  Cd Length: 742  Bit Score: 37.65  E-value: 7.69e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308    4 SDTAPFLSQADDPDDGPAPghPGLPGPMGNPKSGELEVPDCEGLQRITGLSRGHSTLIVVvLCYINLLNYMDRFTVAGVL 83
Cdd:TIGR01299 114 ADGAPKAGVRDELKDGEGP--PGGEGEAERRADEEELAQQYELIIQECGHGRFQWALFFV-LGLALMADGVEVFVVGFVL 190
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   84 TDIEQFFNIGDGSTGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIprEHFWLLLLTRGLVGVG 163
Cdd:TIGR01299 191 PSAEKDLCIPDSGKGMLGLIVYLGMMVGAFFWGGLADKLGRKQCLLICLSVNGFFAFFSSFV--QGYGFFLFCRLLSGFG 268
                         170       180
                  ....*....|....*....|....*.
gi 226958308  164 EASYSTIAPTLIADLFVADQRSRMLS 189
Cdd:TIGR01299 269 IGGAIPIVFSYFAEFLAQEKRGEHLS 294
2A0114euk TIGR00894
Na(+)-dependent inorganic phosphate cotransporter; [Transport and binding proteins, Anions]
98-192 8.91e-03

Na(+)-dependent inorganic phosphate cotransporter; [Transport and binding proteins, Anions]


Pssm-ID: 129972 [Multi-domain]  Cd Length: 465  Bit Score: 37.03  E-value: 8.91e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 226958308   98 GLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPREHFWLLLLTRGLVGVGEASYSTIAPTLIAD 177
Cdd:TIGR00894  79 GLILSSHFYGQIIIQIPVGYLAGKYVFKWSIGIGMFLSSVISIVIPWAAGGGIALVVFCRVIQGLAQGSVSPATHKIIVK 158
                          90
                  ....*....|....*
gi 226958308  178 LFVADQRSRMLSIFY 192
Cdd:TIGR00894 159 WAPPKERSRLLGMST 173
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.14
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH